(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOD

CP002031.NUOD        Location/Qualifiers
FT   CDS_pept        335044..336216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="KN400_0309"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83172"
FT                   /protein_id="ADI83172.2"
FT                   /translation="MASTEIMTVNMGPQHPSTHGVLRMVIELDGEVIQKITPHIGYLHR
FT                   GVEKLSEHRTYHQTIPLTDRLDYLAPMSNNLGYVLAVEKLLGIEIPERAQTIRVIMAEL
FT                   TRLKSHLVWIACHALDIGAMTVFIYAFREREMIMSLYEKISGARMTSNYFRVGGLSSDV
FT                   YDGFEKDVREVIDTFPGHFDTYEGLLTKNTIWVNRTVGNGVISAEDAVDYGITGPALRG
FT                   SGVDWDLRRDNPYSGYEKYSFKVPVGEKCDTFDRYKVRLIEMREAVNIIRQALDSLKPG
FT                   PVLADNPQVTYPPKENVYNSIEGLIHHFKIASEGFPVPEGEVYQSVEAPKGELGYYIVS
FT                   DGGPKPYRMRIRPPSFVNLGAIEKMAKGSMIADLVAVIGTLDIVLGEIDR"
     atggctagca ctgagataat gacagtcaat atgggaccgc agcacccgag tacgcacggc        60
     gttctgcgga tggtcatcga acttgatgga gaggttatcc agaagattac tccgcatatc       120
     ggatatctgc atcggggagt ggagaagctc tccgagcatc gtacctatca ccagaccata       180
     cctctaactg accgtctcga ctacttggcg ccgatgagca ataacctcgg ctatgtgttg       240
     gcggttgaaa agcttttggg tattgagatt cctgagcgcg ctcagacaat tcgcgtcatc       300
     atggctgagc tcacccgtct caaatcccat ttggtctgga ttgcctgcca cgcacttgat       360
     atcggagcga tgacagtctt catctacgct ttccgtgagc gtgagatgat catgagtctc       420
     tatgaaaaga tatccggtgc acggatgacc agcaactact tcagggtcgg tggactttca       480
     tccgatgttt atgacgggtt cgaaaaggat gtgcgggaag tcatcgacac attccccggt       540
     cacttcgata cctacgaagg ccttcttacc aaaaacacca tctgggtcaa ccgtactgtt       600
     ggcaatggcg tgatatcggc tgaggatgcc gtcgactacg ggataaccgg tcctgcactc       660
     cgcggctcgg gcgttgattg ggatttgcgt cgtgacaatc cttacagtgg ctacgagaag       720
     tactcgttca aggttcctgt cggtgagaag tgtgacacct ttgaccgcta caaggtcagg       780
     ctcattgaaa tgcgcgaagc ggtcaatatc atccgccaag cactcgactc gctcaagcct       840
     gggcccgtgc tggctgacaa tccgcaggtc acctacccgc cgaaggagaa tgtttacaac       900
     tctatcgaag gcctcattca ccacttcaag atagccagcg aaggtttccc tgtgccagaa       960
     ggtgaggtgt accagtcggt ggaagctccc aaaggagagc ttggttacta catcgtcagc      1020
     gacggtggcc ccaagccata ccggatgaga ataagacctc cttcatttgt aaacttgggg      1080
     gctatcgaga agatggctaa gggatcgatg attgccgact tggttgcagt catcgggacc      1140
     ttggatatcg tgcttggtga aatcgaccgg taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page