(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOE-1

CP002031.NUOE-1      Location/Qualifiers
FT   CDS_pept        336244..336765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE-1"
FT                   /locus_tag="KN400_0310"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83173"
FT                   /protein_id="ADI83173.1"
FT                   /translation="MSNAPAEATTTEEVPVEEIDLGPANHVIDKYLTLPGNLMPVLQGI
FT                   QDEYGYVPRPTIDLVAERLNVYPSQIFGVLTFYAQFHLKPRGRFIIRVCVGTACHVQGA
FT                   PRIVDTFFEKLGIGHAETTPDLRYTFEKVACLGACGMAPLAMVNDDTFGKMTVQKVEEI
FT                   IAEYNQRPMK"
     atgagtaacg ctccggccga agctacaacc acagaggaag tgcccgttga ggaaatagac        60
     ctcgggccag ccaaccatgt gatcgacaag tacctgaccc tgcccggtaa cctcatgccg       120
     gtgctgcaag gcattcagga tgagtatgga tacgtccccc ggcccaccat cgatttggtt       180
     gccgagagac tcaacgtgta tcccagtcag attttcggcg tacttacgtt ctatgctcag       240
     ttccacctca agccccgcgg ccgcttcatc atccgggtgt gcgtcggaac ggcctgtcac       300
     gtccagggcg ctccgcgaat cgtggacacg ttctttgaga agttggggat tggtcacgct       360
     gagacaacac ccgacctccg ctacacattt gaaaaggttg cctgtcttgg tgcttgtggt       420
     atggccccgc tggcaatggt taacgatgac acgttcggca agatgacggt acaaaaggtc       480
     gaagaaatta ttgccgaata caatcagaga ccgatgaagt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page