(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOF-1

CP002031.NUOF-1      Location/Qualifiers
FT   CDS_pept        336801..338576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF-1"
FT                   /locus_tag="KN400_0311"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83174"
FT                   /protein_id="ADI83174.1"
FT                   /translation="MGEAIKILICQGTGGVSAGAKKVEAEFLRVIGEKGVDATVGKRCD
FT                   VIKTGCRGLCANDVLVDIVDPELGRVTYDFVLPEEVEKIVAEHIVNRTPLEKRKAKPYY
FT                   NTFVDQQMRVVMTGCGQIDPESLDAYLEEDGFKAIEKCVKEMTPAAVIDEVKKSGLRGR
FT                   GGGGFPTGMKWSFCAATPGKLKYVICNADEGDPGAFMDRSILEGDPYCIIEGMMIAAYA
FT                   IGCTAGYVYVRAEYPLAIERLQKALDVCYEKGYLGKNVMGWGFDFDLRIKKGAGAFVCG
FT                   EETALMASIEGERGMPRPRPPFPAVKGLWGKPTNINNVETFANVRHIILKGADWYASLG
FT                   TDTTKGTKIFAVTGKVKHTGLVEVPAGMSVREVIYNVCGGIANNRKFKAVQAGGPSGGC
FT                   IPSEVLDTPVDYDSLIKAGAMMGSGGLVVMDETTCMVDVARFFLTFTRMESCGKCVPCR
FT                   IGLKAMLDILERITEGRGQAGDIETLLEMGSTIKKASLCGLGQTAPNPILSTIKYFREE
FT                   YEAHINDRRCPSNCCKELLLWQVVEEKCVKCGACFKACPVDAIIWEKGQIAILDKEKCT
FT                   KCKSCYDACRFMAIE"
     atgggcgaag cgataaagat tctgatctgt caggggaccg gtggtgtctc agcgggtgct        60
     aaaaaggttg aggcggagtt cctccgtgtt atcggtgaaa agggcgtcga tgccaccgtc       120
     ggcaaacgat gtgacgtcat caagaccggc tgtcgcggcc tgtgtgcaaa cgatgttctt       180
     gtggatattg tagatcccga gcttgggcgt gtaacttacg atttcgttct gccagaagaa       240
     gtcgaaaaga ttgtggccga gcatatcgtc aaccggaccc cccttgagaa gcgcaaagca       300
     aaaccgtact acaacacgtt cgtagaccag cagatgaggg ttgttatgac cgggtgcggt       360
     cagatcgacc cggaaagtct cgatgcgtat ctagaagagg acggcttcaa ggcaattgaa       420
     aaatgcgtta aggaaatgac tcccgctgca gttatcgacg aagtcaagaa gtctggactt       480
     cgaggtagag ggggcggtgg cttcccgacg ggcatgaagt ggtctttctg tgctgcgacg       540
     cccggcaaac tgaagtatgt catctgcaat gcggacgaag gtgaccccgg tgctttcatg       600
     gaccggtcga ttctcgaggg tgacccttac tgcatcattg aaggaatgat gatagcggca       660
     tacgcaatcg gctgtactgc tggctatgtg tacgtacggg cagagtaccc acttgctatt       720
     gagcgtctgc agaaggctct cgatgtttgc tacgaaaagg gctacctcgg caagaacgtc       780
     atgggctggg gattcgactt cgaccttcgg atcaagaagg gtgcgggggc ctttgtgtgc       840
     ggtgaggaaa ccgcgctcat ggcttcgatc gaaggcgagc ggggaatgcc tcgccctcgt       900
     ccgccgttcc ccgctgtcaa aggtctgtgg gggaagccta ccaacattaa caacgttgag       960
     acgttcgcca acgtgcgtca catcatcctg aagggtgctg actggtacgc atctctcggt      1020
     actgatacca caaaagggac aaagatcttc gcggtcaccg gtaaagtaaa gcacacggga      1080
     cttgtggaag tcccggcggg tatgagcgtg cgcgaagtta tctataacgt ttgcggcggc      1140
     atcgccaaca accggaagtt caaagcagtt caggcaggtg gaccatcagg cggatgtatt      1200
     ccctcagaag ttctcgatac accggttgac tatgactcgc ttatcaaggc cggtgccatg      1260
     atgggctccg gtggtctcgt cgtcatggac gaaactacct gcatggtcga cgtagcacgc      1320
     ttcttcctta ccttcacgcg gatggaatca tgcggtaaat gcgttccgtg ccgcattgga      1380
     ctcaaggcga tgttggacat cctcgaacgc atcaccgaag gaagaggcca agctggtgac      1440
     attgagacac tgcttgagat ggggagcacc atcaaaaagg cctcactctg cggtctgggc      1500
     cagacagcac ccaacccgat cctctccacg atcaagtatt tccgtgagga gtatgaagcg      1560
     catatcaatg atcggcgttg cccgtcgaac tgctgtaaag agcttctgtt gtggcaagta      1620
     gtcgaggaaa agtgcgttaa gtgcggagcc tgcttcaagg catgccctgt tgacgcaatt      1680
     atctgggaga aggggcaaat tgcaatccta gataaagaga aatgcaccaa atgcaaatcc      1740
     tgctacgacg cctgccggtt catggccatc gagtag                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page