(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOG-1

CP002031.NUOG-1      Location/Qualifiers
FT   CDS_pept        338617..341097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG-1"
FT                   /locus_tag="KN400_0312"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83175"
FT                   /protein_id="ADI83175.1"
FT                   /translation="MVTLTIDDKQVTVPKDATIFDAAKQAGIRIPILCHDKKLHPFGGC
FT                   RMCLVEVEQMKGRQIPACTTPVTEGMIVRTMTDEIVKARKMVLELLLLKHPIDCPVCDA
FT                   AGDCDLQNLTYEYGVDTNRFTDEKFNWKIDYVNPLIERDMNRCVHCGKCARICDEIVSF
FT                   GAYSFINRGIEAKIGTEFDGPLNCEFCGSCVSVCPVGALISRPFKFKARWWALNKVKTV
FT                   CSYCGTGCQLTLGVKDNKVLTTIYDENQGFHNGQLCTRGRWGYQFVNSSKRLTTPLIRK
FT                   GDTLQPASWDEALGMVADRLKTSKDAAATLVTPRLTNEELYLLKRVVKDAVGSDNLDHS
FT                   GGYAHEALTAGARESLGFPGSPSVIADIQKSELLLVIKTDAYETHPVIGFEVNLAVKRQ
FT                   GVALRILSDKKGKLSRLPGAQTYVHTPGAELVLVNALAKTIVDEGLHDASSVGAIKGFD
FT                   AWLKSIESCTPDQAAGQCGIAADTIKAVAREYAAAGKALIMLPLGMGYPGHGKALAQAL
FT                   INLALLTGRVGKEGCGVLIMGEKNNSQGAADLGIHPTANGLNAQAILAGCSAGSIKTLY
FT                   VVGENPVVSYPNRKQVEAALDAVEFLVVQDLFLTETASKADVVLPACSFAEKDGTFTSL
FT                   GGAVQRVNRAITPLGDCRSDFDILNMLHAKLTGQAAYTSQKEAFADLAAATPGYAGLTL
FT                   EGLGDAGAVRVNNCTASFVPVATSTVTTEAGKFALLTGSALNHSGTLSLYGEGPMLVCP
FT                   EGYLELNKDDAAKLSITEGDAVTMKSATGELRLKAKVGTRLPQGVAFAPYHFAEASINS
FT                   LTGATAITWITISK"
     atggtaactc ttacaatcga tgacaagcag gtaacggtac cgaaagacgc taccatattt        60
     gatgccgcca aacaggcagg aatcagaatt cccatactct gccacgacaa gaagctgcac       120
     cccttcggcg ggtgccgcat gtgcctagtc gaagtcgagc agatgaaggg tcgccagatc       180
     ccggcttgta caacgcccgt tacggagggc atgatagtcc ggaccatgac cgacgagatc       240
     gtcaaggctc ggaaaatggt ccttgaactg ctcctgctca agcaccccat agactgtcct       300
     gtctgtgatg ccgctgggga ttgcgatctc cagaatctga cttatgaata cggcgtagat       360
     acaaaccgct ttactgacga gaagttcaac tggaagatcg actacgtgaa cccgcttatc       420
     gagcgggaca tgaaccgttg cgttcattgt gggaaatgcg cgcggatttg tgacgagatc       480
     gtgtcgtttg gtgcatattc ctttatcaat cgcggtatag aagcaaaaat cggcaccgaa       540
     ttcgatggtc cgctcaactg cgagttctgc ggttcgtgtg tctcggtttg tcccgttggt       600
     gcgctgatta gccgtccgtt taagttcaaa gcgcgctggt gggcactgaa taaggtaaag       660
     accgtttgct cctactgcgg gactggctgc cagttgacgc ttggtgtcaa agacaacaag       720
     gtccttacca ccatctatga tgaaaatcag ggatttcaca acggccagct ctgcactcgt       780
     ggccggtggg gatatcagtt tgttaacagt tccaagcgcc tgaccactcc gcttatcaga       840
     aagggcgata cgctccagcc cgcaagctgg gatgaggcgt tgggcatggt tgccgaccgg       900
     ctcaagactt ctaaagatgc cgcagccaca ttggtcaccc ctcgtcttac caacgaagag       960
     ctttaccttc tgaagcgagt tgttaaggat gctgtcggga gcgacaacct cgaccattcc      1020
     ggcggctacg cacatgaggc tctcactgct ggcgcgaggg agagccttgg attccccgga      1080
     tcgccgtcgg tcatcgccga cattcagaag agcgagcttc ttctggttat caagacggat      1140
     gcgtacgaaa cgcaccctgt tattggcttt gaagtcaacc tagcagtcaa gcgccaaggc      1200
     gtagcgctcc gtattctttc tgacaagaag ggtaagcttt ctcggcttcc cggcgctcag      1260
     acgtatgtcc acacccccgg cgcagagttg gtgctcgtta acgcactcgc caagacgata      1320
     gttgatgaag gacttcatga tgcctccagc gtcggagcca tcaaggggtt tgacgcatgg      1380
     cttaagagta ttgagagctg tacacctgac caagcagctg gtcagtgtgg tattgctgcg      1440
     gacaccatca aggcagtggc gcgtgagtac gcagcagccg gtaaggctct gatcatgctt      1500
     cctctcggga tggggtaccc ggggcatggg aaggcccttg cccaagcact cattaatctc      1560
     gcgcttctta ccggtcgcgt gggtaaggaa ggctgcggtg ttctgatcat gggcgagaag      1620
     aacaatagcc aaggcgcagc agatctcggg attcatccga ccgctaatgg gttgaacgca      1680
     caggcaatcc tggctgggtg ctcagccggc agcatcaaaa cgttgtatgt ggtaggagag      1740
     aatccggtgg tttcctaccc taaccgtaag caggttgaag cagccctcga cgcggttgag      1800
     tttcttgttg ttcaggatct gttcctcacg gaaacagcat ctaaagccga cgttgtactt      1860
     cccgcctgct ccttcgcaga aaaggacgga acgtttacaa gtctcggtgg ggctgtccaa      1920
     cgcgtcaata gagcaattac ccctcttggc gactgccgca gtgattttga catccttaac      1980
     atgctccatg caaagctgac cggtcaggca gcctatacca gccaaaagga agcattcgct      2040
     gatcttgccg cggccacacc cggctatgcg ggtctgactc ttgaaggtct aggggatgct      2100
     ggtgccgtca gagtcaacaa ctgcacggcg tcttttgtcc cggttgcgac cagcactgtg      2160
     acaactgagg cagggaagtt cgcactcctg acggggagtg ccctgaacca ctccggtaca      2220
     ctgtcacttt atggtgaagg accgatgttg gtctgtccgg aagggtatct ggagcttaac      2280
     aaggacgacg ccgcaaaact ctctataacc gagggtgatg cggtaacaat gaagtcggct      2340
     acaggcgaac ttcgtctcaa ggccaaggtc ggcactcgct tgccgcaagg ggtcgcgttc      2400
     gcaccgtacc attttgcaga agcatcaatc aattcgctga cgggcgccac ggctattacg      2460
     tggataacta tcagtaagta g                                                2481
//

If you have problems or comments...

PBIL Back to PBIL home page