(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOJ-1

CP002031.NUOJ-1      Location/Qualifiers
FT   CDS_pept        342627..343130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ-1"
FT                   /locus_tag="KN400_0315"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83178"
FT                   /protein_id="ADI83178.1"
FT                   /translation="METFFFTIVAAVAVLASILVITCKNPINSALSLILTFFCLATFYV
FT                   MLDAPFMAAIQVIVYAGAIMVLIVFVIMLLNVRTEAGRRSSHTVLLGSLVGIFTLVQLF
FT                   YVLNRSSLTGNKGEISPELIHRIGHTEIIGKALYTDFLLPFEVTSILLLVAIIGAVILT
FT                   KKKI"
     atggaaacgt tcttcttcac gatcgtggca gcggttgctg tactggccag catactggtc        60
     atcacctgca agaacccgat caacagcgcg ctctccctta tcctgacgtt cttctgtctt       120
     gccaccttct acgtgatgct cgacgctccg ttcatggcgg ccattcaggt gatcgtctac       180
     gctggggcca ttatggtgct aattgtcttc gtcataatgc ttctcaacgt gcggactgag       240
     gccgggagac gctcctctca caccgtgctt ctcggctcgc tggtcggtat atttacgctt       300
     gttcagctgt tctatgtact caatcggagc tctctcactg gcaacaaggg tgagatcagc       360
     cctgaactga tacatcggat cgggcacact gaaattatcg gcaaagcact ctacacggat       420
     ttccttttgc cttttgaggt gacatccata ctgttgcttg ttgccataat tggtgccgta       480
     atactgacta agaaaaaaat ctaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page