(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOK-1

CP002031.NUOK-1      Location/Qualifiers
FT   CDS_pept        343149..343451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK-1"
FT                   /locus_tag="KN400_0316"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83179"
FT                   /protein_id="ADI83179.1"
FT                   /translation="MVSLHSYLIVSAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLT
FT                   FIALSRHLGNIDGQIFVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDVKLMKL"
     atggtatcct tgcacagcta cctgatagta agcgcaatac tgttttcgat cggcaccatt        60
     ggtgttctcg tcaggcgtaa tgcaatagtt atatttatgt gtgtcgagat gatgttgaat       120
     gctgtaaacc tgacattcat cgcactctca aggcatctcg gcaatatcga tgggcaaatt       180
     tttgtcttct ttgtcatgac tgtggcagct gccgaagctg ctgtgggtct ggcgctcatg       240
     atcgcgttct acaaaaaccg tgagtccata gacgtagaag atgtcaagct catgaagctg       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page