(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOL-1

CP002031.NUOL-1      Location/Qualifiers
FT   CDS_pept        343505..345505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL-1"
FT                   /locus_tag="KN400_0317"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83180"
FT                   /protein_id="ADI83180.1"
FT                   /translation="MFEYVWLIPLFPLIGVIINGLFGKSIKNEKVIGGIGALMVFCSFL
FT                   VSCGILIQLLSLPVEERFFEKSLFTWIAAGTFKTDIGFLIDPLSTLMIMVVTGVGFLIH
FT                   VYSIGYMHGEEGFYRYFTYLNLFTFSMLLLVLGSNLLLMFVGWEGVGLCSYLLIGYYFH
FT                   KKSAGDAGKKAFVMNRVGDFGFLLGTFTLFWYLGQNHNVWTINFRELSANAHLLPVGGI
FT                   VTVITLCFFLGATGKSAQIPLYTWLPDAMEGPTPVSALIHAATMVTAGVYMIGRLNFVY
FT                   IRSHETMMIVAIIGAATAIFAATIGTAQNDIKRVLAYSTVSQLGFMFLAMGVGAFTAGI
FT                   FHLMTHAFFKACLFLGSGSVIHAMHHALHHAHSHDDPQDMRNMGGLRKAMPITFLTFLA
FT                   STIAIAGIPGFSGFFSKDEILWQAFANPLHGSLNMILWGTGAVAAGFTAFYMFRLVFMT
FT                   FTGECRINPKAKDHLHESPFVITFPLIVLGILAVVGGYVGMPKVLGMLPNYLEHYLEPV
FT                   FVGSHEFMQQQLQGHGEAHHSHALEFGLMGLSVLIALVGISIAYVLYVMSPSLPAKFTA
FT                   AFPALHRAVYNKWYVDELYDFLFVNPCKALGNFLWKGFDVVVVDGMVNGVAAVVKGFGS
FT                   VLRNTQTGYVHNYAFSMAVGVVVIVAFYLFR"
     atgttcgagt acgtatggct gatacccctg tttcccctga tcggtgtcat tattaatggc        60
     ctatttggga aatcaatcaa gaacgagaag gtcattggtg gcattggcgc actgatggtg       120
     ttctgttcat ttctcgtgtc gtgcggaatt ctcattcagt tgctttcact ccctgtggag       180
     gagaggttct ttgagaagtc cctcttcaca tggatcgctg ccggtacatt taagactgac       240
     attggtttcc tcatcgaccc gctctcgaca cttatgatca tggtggtaac cggtgtcggt       300
     ttcctgattc acgtttactc cataggctac atgcacggcg aagaagggtt ttaccggtac       360
     tttacttacc tgaacctctt cacgttctcc atgcttttgc tggtcctggg cagtaacctg       420
     ctcctgatgt ttgtcggttg ggaaggtgtc ggtctctgtt cctatctgct catcggttac       480
     tacttccata aaaaatccgc tggtgatgct ggcaaaaaag cattcgtgat gaaccgggtc       540
     ggtgattttg gcttccttct cggtacattt acgctgttct ggtatcttgg ccagaaccat       600
     aatgtatgga ccatcaactt ccgtgagctt tccgctaatg cacacttgct gcccgtaggt       660
     gggatagtta cggtaatcac gctctgcttc ttcctgggag ccaccggcaa atctgcacag       720
     atacccctct atacatggct tcccgacgcc atggagggtc ccacacccgt atcagccctc       780
     atccatgccg caacaatggt tactgcgggt gtgtacatga ttggccgcct gaatttcgtg       840
     tacatcagat cgcatgaaac aatgatgatt gttgcaatta tcggtgcggc aaccgcgatt       900
     ttcgccgcga ccatcggtac ggctcagaat gatatcaagc gagttctggc atactccacg       960
     gtttctcagc tcgggttcat gttccttgca atgggcgttg gtgcattcac tgcaggtatc      1020
     ttccacctca tgacccacgc ctttttcaag gcatgtctgt tccttggttc cggttcggtt      1080
     atccatgcaa tgcaccatgc actccatcat gcgcactctc atgatgaccc gcaagacatg      1140
     cgcaacatgg gcggtctgcg caaggccatg ccgattacct tcctgacatt ccttgcttca      1200
     accattgcta ttgcaggtat tcccggcttc tccggcttct tctcaaagga cgagattctc      1260
     tggcaagcgt ttgccaaccc cctgcatggc agtctcaata tgattctgtg gggtactggt      1320
     gccgttgccg cagggttcac agccttctac atgttccgct tggtgttcat gacgttcact      1380
     ggcgagtgcc ggattaaccc gaaggccaag gatcatctcc atgagtcacc ctttgttata      1440
     acgttccctc ttattgtcct tggcatactc gccgtagttg gaggctatgt ggggatgccc      1500
     aaggttctgg gcatgctgcc caactacctt gagcactatc ttgagcctgt ctttgttggg      1560
     tcccacgagt tcatgcagca gcagctgcaa gggcatggtg aagcacatca cagccacgca      1620
     cttgagtttg gactcatggg actgtcggta ctcattgcac tggtgggtat atcgattgcc      1680
     tatgtcctct atgtgatgtc tccgtcactg cccgcaaagt ttacagccgc gttcccggcg      1740
     ctccacaggg ctgtatacaa taagtggtac gtggatgagc tctatgattt cctcttcgtt      1800
     aatccgtgca aggctctcgg caatttcctg tggaaaggat tcgacgttgt agtcgtcgat      1860
     ggtatggtca atggagttgc cgctgttgtg aaaggattcg ggagtgttct tcggaacacc      1920
     cagaccggtt acgtgcacaa ctatgccttc tccatggctg ttggcgtggt ggtgatcgta      1980
     gcgttttacc tcttccgcta a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page