(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOM-1

CP002031.NUOM-1      Location/Qualifiers
FT   CDS_pept        345539..347107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM-1"
FT                   /locus_tag="KN400_0318"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83181"
FT                   /protein_id="ADI83181.1"
FT                   /translation="MSQFPLISVMTFLPLLGVVLLFFVPKQSHSVHRMLALLVSLVTFV
FT                   VSIPLVTGFQSNADFQFVEKMPWIAAGPFQMNYHVAIDGISLWLVLLTTFIMPIAILST
FT                   WTAVEEKVKEYMICLLLLEVGMLGAFVSLDLFLFYIFWEVMLIPMYFIIGIWGGKNKIY
FT                   AAVKFFIYTMVGSMLMLVALVTLYFKAGAGDFNVLRFYEVTLDPATQVWMFLAFALAFA
FT                   IKVPMFPLHTWLPDAHTEAPTAGSVILAAVLLKMGTYGFVRFAMPLFPDATDKFTPLIA
FT                   TLSVIGIIYAALVAMVQEDVKKLVAYSSVAHLGYVMLGVFALNLQGLSGGMLQMLNHGV
FT                   STGALFLIVGFIYERRHTRLITDFGGLAKQMPVFATIFMIVTLSSIGLPGTNGFVGEFL
FT                   VLLGAFESELRWYAVIGTSGVILAAVYMLWMFQRVMFGELTNPKNQTLCDLNAREVGIM
FT                   LPLLVLIFVMGVYPTPFIEKMSPSLEKLIVHVKTKQQGAVAQVETVPAAPQVMPAAAVV
FT                   PAEHK"
     atgagccagt ttccgttaat cagcgtgatg acctttcttc cactcctggg ggtcgtactg        60
     ctcttcttcg tccccaagca gagccactcg gtgcacagga tgctcgcctt gctggtctct       120
     ctggtgacct ttgtcgtgtc gatacctctg gttactggat tccagagtaa cgccgacttc       180
     cagttcgtgg agaaaatgcc gtggatagct gcgggtccgt tccagatgaa ctatcacgtt       240
     gcaatcgatg gtatcagtct ctggctcgtt ctcctcacga catttatcat gccgatcgcc       300
     atcctctcta cctggacagc ggtagaagag aaggtcaagg agtacatgat ctgcctcttg       360
     ctgcttgaag tgggaatgct tggagctttc gtgtcgcttg atctcttcct gttctacatc       420
     ttctgggaag tgatgctcat accgatgtat ttcatcatcg ggatctgggg tggtaaaaat       480
     aagatttatg ctgcagtcaa attcttcatc tacacgatgg ttggctccat gctcatgctg       540
     gtcgctctgg ttaccctcta cttcaaggca ggggctggag acttcaacgt gctcaggttc       600
     tatgaagtaa ctcttgatcc ggcaacacaa gtctggatgt tcttggcctt tgccctggca       660
     tttgccatca aagtgcctat gttccctctc cacacgtggc ttccggatgc tcacaccgaa       720
     gcgccgacgg ccggctcggt cattctggct gcagtgctcc tgaagatggg gacttacggt       780
     ttcgttcgtt ttgcaatgcc gctcttcccc gacgcaaccg ataaattcac ccccctcatt       840
     gctacgcttt cggttattgg catcatatac gctgcccttg ttgcaatggt ccaagaagat       900
     gtcaagaagc ttgtagcgta ctcatctgtt gctcacctgg gctacgttat gctgggtgtg       960
     ttcgcactga atcttcaagg actttccggt ggaatgctgc aaatgctcaa ccacggtgtc      1020
     tcaaccggcg cactgttcct catcgttggc tttatttatg agcgccgcca cactcgactg      1080
     atcacggatt tcggagggct cgccaagcaa atgccggtgt tcgctacgat atttatgatc      1140
     gtcacgcttt cctcgatcgg tctacccggc acgaacggtt tcgtagggga attccttgtt      1200
     cttctcggtg cgtttgaaag tgagcttcgt tggtatgctg taatcggtac aagtggtgtt      1260
     attctggcag ccgtttacat gctctggatg ttccagcgcg ttatgttcgg ggagctcaca      1320
     aacccaaaga accagacctt gtgtgatctg aatgcacgtg aagtcgggat catgcttccg      1380
     ctactcgttc tgatcttcgt gatgggtgta tatcccactc ctttcattga gaagatgagt      1440
     ccttcacttg agaaactcat tgttcatgtg aagaccaagc agcagggtgc cgttgctcag      1500
     gtggagaccg tgcctgctgc tccccaggtc atgcctgcag ctgctgttgt gcctgcagaa      1560
     cataagtaa                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page