(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE123

CP002031.PE123       Location/Qualifiers
FT   CDS_pept        134639..135754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0125"
FT                   /product="motility response receiver histidine kinase"
FT                   /note="domains: REC, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82988"
FT                   /protein_id="ADI82988.1"
FT                   /translation="MDIVTKMQSERGLKSILVVDDESVIRDLCAKALKGYRVLQAGDGE
FT                   EALRLFERGGIDVILTDVMMPKLNGIELLRRLKEMEPTLVVIVMTGYAEKDIILNALKA
FT                   DADDFITKPLNLLQLKTAVDRALDKKVLKEEIANLKSMDRLKSNFLSLISHKFRTPLTA
FT                   ISLFLQNLACGVYDPEDPESRRNLELIFGQSRYLESLVSELLAFSRFMDAEAGLQLEPC
FT                   LLQDLIPKLVTSSREAVAKPGIVTSFDLAPLPPISLDREKITFAIGQIIDNAYKFSRER
FT                   GKITITLRESGDEYLLAVEDTGVGIPRDEIPKIFEKFYQVDPEGTGQIRGFGLGLFYAR
FT                   EFVKLHDGTISIESEAGAGTRVTIALPSAAT"
     atggatatcg tgaccaagat gcagtctgag cgcggtctca agtcgattct cgtcgtggat        60
     gacgaatcgg tgatccgcga cctgtgcgcc aaggccctca aggggtaccg ggtccttcag       120
     gccggcgacg gcgaagaggc cctgcgcctg ttcgagcggg gggggatcga cgttatcctc       180
     accgacgtaa tgatgccgaa gctgaacggc atcgagctcc tgcggcgcct caaggagatg       240
     gagccgacgc tcgtagtcat cgttatgacc ggttacgccg aaaaggatat catcctcaat       300
     gcgctcaagg cggacgccga cgacttcatc accaaacccc tgaacctgct gcagctcaag       360
     acggcagtgg accgcgcctt ggacaagaag gtcctcaagg aggagatcgc caatctcaag       420
     agcatggacc ggctcaagag caactttctg tcgctcatct cccacaagtt ccggacgccg       480
     ctcaccgcca tctcgctctt tctccagaat ctcgcgtgcg gcgtctacga ccccgaggac       540
     cctgaatccc gcaggaacct ggagctcatc ttcggccagt cccgctacct ggaaagcctg       600
     gtgagcgaac tcctcgcctt cagtcgcttc atggacgccg aggcgggcct ccaactagag       660
     ccgtgcctgc tgcaggacct gattcccaag ctcgtcacgt cctcccgtga ggcggtcgcc       720
     aagcccggca tcgtcacctc cttcgacctg gccccgctgc ctcccatctc cctggaccgt       780
     gagaagatta ccttcgccat cggccagatc atcgacaacg cctacaagtt ttcccgggag       840
     agaggcaaga tcaccatcac tctcagggag tcgggcgacg agtacctgct ggccgtcgag       900
     gacacgggcg tgggcatccc ccgtgatgaa atacccaaaa ttttcgagaa gttctaccaa       960
     gtggaccccg aaggtaccgg tcagatccgc ggtttcggcc tcggcctttt ctacgcgcgc      1020
     gagttcgtca agctccacga tggcaccatc tctatcgaga gcgaagccgg agctggaacc      1080
     cgggtcacca ttgccctccc cagcgcagcc acctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page