(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE129

CP002031.PE129       Location/Qualifiers
FT   CDS_pept        140828..141991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82994"
FT                   /protein_id="ADI82994.1"
FT                   /translation="MVQIIDKKVNLEYPLGHHLHCMIAQVPNHLRGAEKGFAIEEPDRQ
FT                   WERVRSILDLVAAGEGNLKKLHFLMFPETHVPVGRFDEMLTAISGTFRPNTVTMFGVEH
FT                   VSLKAYREMLERFREDNAEAIELVDRDIDSGDVLEMPVNWCCIAVKEATGKLRVFLEAK
FT                   SHPFHGEEFLDKFHDLYRGRHFYLFRSRPSCFNFMVLICLDYLYRDLYSSNIKQIIDHA
FT                   NQLYFSTRQTLDTIFVVQCNPKPEHRAYRDVLAGFYGEYLEDTPGVRETVTVFGNTSEE
FT                   TRIEDVPGGHAFGTSSVVINSSHRLARVQLSEFATDDFDGAPICRLRFGTGTRLYYFNL
FT                   PLHHEIDPRTTRVPLKVHTIMRPSRDGGWVKISGDELVAGFEIAQDA"
     atggtccaga tcatcgacaa gaaggtgaat ctcgaatatc ccctggggca ccacctccac        60
     tgcatgatcg cccaggtgcc gaaccacctg cggggggcgg agaagggatt cgccatcgag       120
     gagcccgacc gccagtggga gcgggtccgg tcgatcctcg acctggtggc ggccggcgag       180
     gggaacctga agaagctcca cttcctcatg tttcccgaga cccacgtccc ggtcggccgg       240
     ttcgacgaga tgctgaccgc gatcagcggc accttccgcc ccaacaccgt caccatgttc       300
     ggggtggagc acgtgagcct caaggcctac cgggagatgc tggagcggtt ccgggaggac       360
     aacgccgagg ccatcgagct ggtggaccgg gacatcgatt cgggcgatgt gctggagatg       420
     ccggtcaact ggtgctgcat tgcggtgaag gaggccacgg ggaaactgcg tgtcttcctg       480
     gaggccaaga gccacccctt ccacggggag gaattcctgg acaagttcca cgatctctac       540
     cgcgggcgcc acttctacct cttccggagc cgcccctcct gcttcaactt catggttctg       600
     atctgtctgg actaccttta ccgggacctg tacagctcca acatcaagca gatcattgac       660
     cacgccaacc agctctactt ctccacccgg cagaccctgg acaccatctt cgtggtccag       720
     tgcaacccca agcccgagca ccgggcctac cgggacgtgc tcgccgggtt ctacggcgag       780
     tacctggagg acacgcccgg cgtgcgggaa acggtaacgg tcttcggcaa tacctcagag       840
     gagacccgga ttgaggatgt ccccggcggg cacgccttcg gcacctcctc cgtggtcatc       900
     aacagcagcc accgcctggc gcgggtgcag ctctcggagt tcgccaccga cgatttcgac       960
     ggcgctccga tttgccggct tcgcttcggg accgggaccc gtctctacta cttcaatctt      1020
     ccgctccacc acgagatcga tccgcgcacc acgcgggttc ccctcaaggt ccacacgatc      1080
     atgcgcccgt cccgggacgg cggctgggtc aagatcagcg gggatgagct ggtggcgggg      1140
     ttcgagatcg cgcaggacgc ataa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page