(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE141

CP002031.PE141       Location/Qualifiers
FT   CDS_pept        152145..153311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0142"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83005"
FT                   /protein_id="ADI83005.2"
FT                   /translation="MFTEVSPRGGRLVVQQKGAEGYSAFVPHPLPPNPPLQIDDEMGWL
FT                   MERANRALGRLDGCTYTLPNPDLFLYMYVRKEAVLSSQIEGTQASLDDLLEYEGEIEGK
FT                   SSPDDINEVSNYVDAMNYGLERLQELPLSLRLIKEIHARLMAGIRGGHKSPGEFRTSQN
FT                   WIGGTRPGNAAFVPPPANEVVTCLGDLEKFLHDESVPPLLKAGLAHAQFETIHPFLDGN
FT                   GRMGRLLIAFILCHDQVLEKPLLYLSLFFKKHRQEYYERLNAVRRDGDWEGWIKYYLQG
FT                   VYEISKQATDAAKAIMDLMARDRQKVTGLGKAAPTALALLEMLYRKPYVTIPYVARELR
FT                   ISSPAASKAVNNLAALGILIEVSGKKRDRVFLHESYLSIIREGTELYR"
     atgtttacgg aagtatcgcc gcgcggcggc aggctggtgg tacagcaaaa aggtgcagaa        60
     ggttacagcg cttttgtgcc acatccgcta ccgcccaatc caccgctgca gatcgacgac       120
     gaaatgggat ggctgatgga gcgggccaac cgtgccttgg gccggctgga cggctgcacc       180
     tataccctcc ccaaccctga cctgttcctc tacatgtacg tgcgcaagga ggcggtgcta       240
     agttcccaga tcgaggggac gcaggcgtca ttggacgatc ttctggagta cgaaggagag       300
     attgagggta agagctcacc ggacgatatc aatgaggtgt ccaattatgt ggatgccatg       360
     aattacggcc tggagcggtt gcaagagctg cccctgagtc tgcggctgat caaagagatt       420
     catgcccggc tgatggccgg catcaggggg gggcacaaga gtcctggcga gttccggaca       480
     tcccagaact ggatcggtgg cacaaggccg ggtaatgccg ccttcgtgcc gccgccggcc       540
     aatgaggtag ttacctgtct gggcgacttg gagaaatttc tgcacgatga gtcagttccg       600
     ccgctgctca aggctggcct ggcccatgcc cagtttgaga ccatccaccc gtttctggac       660
     ggcaacggca gaatggggcg gctgttgata gcctttattc tctgccatga tcaggtactg       720
     gaaaagccac tgctctactt gagtctcttt ttcaaaaagc accgccagga gtactacgag       780
     cggctcaacg cggtccggcg agacggcgac tgggaggggt ggatcaagta ctacctgcag       840
     ggggtatacg agatatcgaa acaggcgacc gatgccgcca aagcgatcat ggacctgatg       900
     gcgcgggaca gacagaaggt aaccggcctg ggcaaagcag caccaacggc gttggctctt       960
     ctggagatgc tctatcgcaa gccctacgtc accatcccgt acgtggcgcg ggaactccga      1020
     atcagctccc cggcagcaag taaggcagtg aacaatcttg cggcactcgg cattctgatc      1080
     gaggtgagcg gcaagaagcg cgatcgggtg ttcctgcacg aatcctacct gtccatcatc      1140
     cgggaaggga ctgagctata ccggtag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page