(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE146

CP002031.PE146       Location/Qualifiers
FT   CDS_pept        156887..157618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0147"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83010"
FT                   /protein_id="ADI83010.1"
FT                   /translation="MYQEPEPGLYRHYKGGEYRVVGTARHSETDEPMVVYRCLYDNNSL
FT                   WVRPLAMFLGTVAVDGAERPRFSLVAPDRSGGPAAAELIAGLGLERHPEGGWYRETYRA
FT                   AGTIPGTLLPGQVGGERSFSTAIYFLLERGDISALHRIRSDELWHFHAGAPLIVHVITP
FT                   AGGSYALTLGSDPASGETFQAVVPAGCWFGAETTGDYSLVGCTVAPGFDFADFEMGSRA
FT                   DLLGRFPTHAGIIRRLTRDGD"
     atgtaccaag aaccggagcc ggggctctac cggcactaca aggggggtga gtaccgggtg        60
     gtcggcacgg cccgccacag cgagacggac gaacccatgg tggtctaccg ctgcctctac       120
     gacaacaatt ccctctgggt gcggccattg gcgatgttcc tgggaacggt ggccgtggac       180
     ggtgccgaac gcccccgttt cagcctcgtg gcccccgacc ggtccggcgg accggccgcc       240
     gcggagctga ttgccggcct tggcctggag cgtcatccgg agggtggctg gtaccgggaa       300
     acctaccggg cggccgggac cattcccggc acgcttctgc cgggacaggt cggcggcgag       360
     cgctcctttt cgacggccat ctactttttg ctggagcggg gcgatatttc ggccctgcac       420
     cggatcaggt ccgacgaatt gtggcacttc catgccggtg cgcccctgat cgtgcatgtg       480
     atcaccccgg cgggcggcag ctatgccctg acgttgggga gcgatccggc gtcaggggaa       540
     acgttccagg cggtggtgcc agcgggctgc tggttcggcg ccgagaccac gggcgattat       600
     tccctggtgg ggtgcaccgt ggcccccggg ttcgatttcg ccgatttcga aatgggaagc       660
     cgcgccgatc tgcttggccg attcccgacc catgccggca tcatccggcg gctgacccgg       720
     gacggggact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page