(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE154

CP002031.PE154       Location/Qualifiers
FT   CDS_pept        complement(163200..164129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0155"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, TPR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83018"
FT                   /protein_id="ADI83018.2"
FT                   /translation="MTFTRHRMAARFFPVCICCMLLLCGCSHHRAASIFQEANDLFSQG
FT                   NYSASLDAYTRIGETHPAAKDRVLFEKGFIHAYPRNEHKDYQKALECFEQLVREFPESR
FT                   YRQDSERMIFGINTVVLKDGTIAAQQARIEALRQDLDDRNKDIAALRETIKILEQKVFA
FT                   IATRKGAVDKILIEKKDRRLSLLSMGEVIRTYKVALGGNPVGPKERQGDNKTPEGSYVI
FT                   EGRNKGSRYHLSLRISYPNEKDKKRAREMGVSPGGDIMIHGIKNGLSQVGAAHAEVDWT
FT                   QGCIAVTDEEIEEIAEAAPNGTVVEIRP"
     atgacattca cacgacacag gatggctgcg cgctttttcc cggtctgcat ctgctgcatg        60
     ctgcttctct gcggctgcag ccaccatcgg gccgcgtcga tcttccagga ggcgaacgac       120
     ctgttctccc aggggaacta cagcgcctcc ctcgacgcat atacccgtat tggcgaaacc       180
     catcccgccg cgaaagaccg ggtgctgttc gaaaagggat tcatccatgc ctatcccagg       240
     aatgaacaca aggattacca gaaagccctg gagtgcttcg aacagctggt cagggagttc       300
     ccggagagca ggtaccggca ggatagcgag cggatgatct tcggcatcaa caccgtcgtg       360
     ctcaaggacg gcaccattgc cgcgcagcag gcccgcatcg aagcgctcag gcaggatctc       420
     gacgacagaa acaaggacat cgccgccctg cgggaaacga ttaaaatcct cgagcaaaag       480
     gtatttgcca ttgccacccg gaagggggcg gtggacaaaa tcctgattga aaagaaagac       540
     cgcaggctgt cgctgctctc aatgggcgag gtgatcagga cctacaaggt agccctgggg       600
     ggcaacccgg tgggccccaa ggaacggcag ggcgacaaca agaccccgga ggggtcctac       660
     gtcatcgagg ggaggaacaa gggcagccgc tatcacctgt ccctgcgcat ctcctatccg       720
     aacgaaaaag ataaaaagcg ggcacgggag atgggagtct ctccgggcgg ggacatcatg       780
     attcacggca tcaagaacgg gctctcgcag gtcggcgccg cgcacgccga ggtggactgg       840
     acccaggggt gcatcgccgt aaccgacgaa gagattgagg aaattgcaga ggcggcgccc       900
     aacgggacgg tggtcgagat caggccatag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page