(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE156

CP002031.PE156       Location/Qualifiers
FT   CDS_pept        complement(164686..165993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0157"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, SPOR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83020"
FT                   /protein_id="ADI83020.1"
FT                   /translation="MRRIVTLPTVAYWLRSAVLGICVIALTGCAATRQAWFSPVHPESE
FT                   LERNRFQVAPGTDVIGRLGLVKLEEGDTLPDVARHFSVGINAISAANPGVDVWLPKAGQ
FT                   RITLPLNFILPDAPRKGIVINLATMRLFQFKENGGALAVSTYPVGIGTKERPTPQGPTR
FT                   VARKASRPTWYVPASIAEDHRKKGDILPARVPPGPENPLGDYALYLSRSGYLIHGTNKP
FT                   ASIGLKASNGCMRLYPEHIEVLFRDTAVNTPVLIVNQPYLIGQRDGVLYMEAHTPLEDS
FT                   GTSELARIHAKLKSFESASARTLDWDKIKQVQAEARGIPVPILELRPGAEQEAASPLRI
FT                   EHPAALYGRPELPALKLDAWYVMVGDMRDEMEARRMAAIINHQGPPIPARVLSKDSSYR
FT                   IIAGPFSDDGKARDAAKRLKIDLDIDGIVIEPGRTI"
     atgcgcagaa tcgttacgct gccaaccgtg gcctactggc ttcgttccgc tgtcctgggc        60
     atctgcgtca ttgccctcac gggctgtgcc gccacccggc aagcctggtt ctcaccggtc       120
     caccctgaaa gcgaacttga acggaaccgg ttccaggttg cgccgggaac tgacgtcatc       180
     ggccgactgg ggctggtcaa actcgaagag ggggatacgc tgccggatgt ggcgcggcac       240
     ttcagcgtgg gcatcaatgc catcagcgca gccaatccgg gggttgatgt gtggctgccc       300
     aaggcaggcc aacgcattac cctgcccctg aacttcatcc tgccggatgc cccccggaag       360
     ggaatcgtga tcaacctggc caccatgcgg ctctttcagt tcaaggaaaa cggcggagcc       420
     ctggccgtgt cgacctaccc ggtcggaatc gggaccaagg agcggcccac cccccaggga       480
     ccgacacgcg tggcgcgcaa ggccagccgg ccgacctggt atgtgcccgc ctccatcgcc       540
     gaagatcacc ggaaaaaggg ggacattctc cctgcccggg taccgccggg gccggagaac       600
     cccttgggag actacgcgct ctatctgagc aggtcgggct acctgatcca cggcaccaac       660
     aaaccggcca gcatcggcct gaaggcatcc aatggctgca tgaggctcta tccggaacat       720
     atcgaggtgc tgttccggga tacggcggtc aacaccccgg tgctcatagt caatcagccc       780
     tatctcatcg gccagcgcga cggcgtgctc tacatggaag cccacacccc cctggaggat       840
     tcgggcacca gtgaactggc ccggatacat gcgaagctga aatcctttga aagcgcatcg       900
     gcgcgaacgc ttgactggga caagatcaaa caagtccagg ccgaggcccg ggggattccc       960
     gtccctattc tggagctgag gccgggagcg gagcaagagg cggcctcgcc cctgagaatc      1020
     gagcacccgg cagcgctgta cggcaggccg gagctgccgg cgctcaagct ggacgcatgg      1080
     tatgtcatgg tcggcgacat gcgcgacgaa atggaagccc ggaggatggc cgccatcatc      1140
     aaccatcagg ggccgccgat cccggcccgg gtgctgtcga aggattcgag ctaccggatc      1200
     atcgccggcc cgttcagtga cgacggcaag gccagggatg cggccaaacg gttgaaaatc      1260
     gaccttgaca tagacggcat cgtgatcgaa cccggcagga ccatctga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page