(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE158

CP002031.PE158       Location/Qualifiers
FT   CDS_pept        complement(167251..168456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0160"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83023"
FT                   /protein_id="ADI83023.2"
FT                   /translation="MTSLRRNIPLLYAFSFLQMTLFPMAVITLFWKDQIGLSLSEILLL
FT                   QSIFAVAMAVMEYPSGYISDRIGYRAALTAASALGIAGWAVYTAATSFRDVLIAEILLG
FT                   IATSFISGTDSALLYESLKEQGEETAYARHEGRSTFFGQTGEAAGALFAGVLYARYPLL
FT                   PFFLQVGVWVLALFLTRRLTEPARERHHQASHLKEALASASYVFVRNRRLRATILLSIA
FT                   LGLASFYPVWLIQPYMRDSGVPLASFGPIWAGANLVVALFAVLSHRVRAGLGDRPMLLL
FT                   LVLLVWVGYLGLGWTAGAWSFLFYYLLTAMRGMRGPLLLHLVQDEIPSANRAGMLSLQS
FT                   LCFRLLFACTAPLVGRYADAAGAGGTFRLLAAAYLLVLPPLVYLFFRHLHADGSSACKG
FT                   GT"
     atgacctccc tccggcgcaa cattcccctg ctctatgcct tctccttcct gcagatgacc        60
     ctgttcccca tggcggtcat cacgctcttc tggaaggacc agatcgggct gagcctgtcc       120
     gaaatcctgc ttctgcagag catcttcgcc gtggccatgg cggtgatgga atacccctcc       180
     ggctatatca gcgaccggat cggctaccgg gcggccctga ccgcggcctc ggccctggga       240
     atcgcaggat gggcggtcta tacggcggcc acatcgttca gggacgtcct tatcgccgag       300
     atcctcctcg gcattgccac ctcgttcatc agcggcactg acagtgcact cctctacgaa       360
     tccctcaagg aacaggggga agaaacggcc tatgcccgcc acgaagggcg ctccaccttt       420
     ttcggccaga ccggtgaggc agccggggcg ctctttgccg gcgtcctcta tgcccgctat       480
     ccccttcttc cattttttct gcaggtgggg gtctgggtgc tggccctttt cctgacgcgc       540
     agactgaccg agcccgcacg ggagcggcac caccaggcca gccatctgaa ggaggcactt       600
     gcctcggcca gctacgtttt cgtccgcaac cggcgcctgc gcgccaccat cctgctcagc       660
     atcgcgctcg gcctcgcctc cttctatccg gtctggctga tccagcccta catgcgcgac       720
     agcggcgtgc ccctcgcctc cttcggcccg atctgggccg gggctaacct ggtcgtggcc       780
     ctctttgccg tactgagcca ccgggtgcgg gccgggctgg gggaccgccc gatgctcctg       840
     ctcctggtgc tgctggtctg ggtcggctac ctggggctgg gttggacggc gggggcatgg       900
     agctttctct tctactacct gctcacggcc atgcggggga tgcgggggcc actcctcctc       960
     cacctggtcc aggacgaaat cccctcggcc aaccgggccg ggatgctgtc gctgcagtcc      1020
     ctctgcttcc ggctcctgtt cgcctgcacc gcccccctgg tgggacgcta tgccgatgcc      1080
     gctggcgcgg gcggcacctt ccgtctcctc gccgcagcct acctgctcgt tctgccgccg      1140
     ctggtctatc tcttcttcag gcacctgcac gcggatggct cctctgcctg caagggcggg      1200
     acttga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page