(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE166

CP002031.PE166       Location/Qualifiers
FT   CDS_pept        complement(173113..174252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0168"
FT                   /product="glucose/sorbosone dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83031"
FT                   /protein_id="ADI83031.1"
FT                   /translation="MHPIKTLRFLLAHLFLLAAATGCNAARTLPAAITLPPGFSIAVYA
FT                   DNVPGARSMALGAKGTLFVGSRGEGKVYALADRNSDQVADEVITIAKGLQMPNGVAFRN
FT                   GSLYVAEVSRVLRYDAIEERLKNPPPPVVVNDSFPDRTHHGWKFIRFGPDGRLYVPVGA
FT                   PCNVCEEKDPRFATIMRMNPDGTGLEIFANGVRNTVGFDWHPRTGELWFTDNGRDWLGN
FT                   DLPPDELNRAPRSGLHFGFPYRHGRDIPDPEFGAKRKPDQLVAPEMELGPHVAALGMRF
FT                   YNGTMFPERYRNQIFIAEHGSWNRSERIGYRVVLVRLEGNRAVSYEPFAEGWLDNDKVW
FT                   GRPVDVQVMPDGSLLVSDDKAGAIYRISYRQQPLAHGAQ"
     atgcacccga tcaaaaccct tcgattcctg cttgcccacc tgttcctgct ggctgctgcc        60
     acgggctgca acgccgcccg gacgctgccg gccgccatca cgctcccccc cggattcagc       120
     atcgccgttt atgccgacaa cgtgccgggg gcccgctcca tggccctcgg cgccaagggg       180
     accctgttcg tggggagccg tggggagggc aaggtctacg ccctggcgga ccgcaacagc       240
     gaccaggtgg ccgacgaggt aatcaccatc gccaaggggc tgcagatgcc caacggtgtg       300
     gccttccgaa acggctccct ctacgttgca gaggtgagcc gggtgctgcg gtacgacgcc       360
     atcgaagagc gcctgaaaaa tcccccgccg ccggtcgtcg tcaacgactc cttcccggac       420
     aggacccacc acggctggaa attcatccgt ttcggccccg acggcaggct ctacgtgccg       480
     gtgggggccc cgtgcaacgt ctgcgaggaa aaggaccccc gtttcgccac catcatgcga       540
     atgaatccgg acggcaccgg cctggagatc ttcgccaacg gagtccgcaa cacggtgggc       600
     tttgactggc acccccgcac cggcgaactc tggttcacgg acaacggccg cgactggctg       660
     gggaacgacc tgccgccgga cgagctcaac cgggcgcccc ggtccggtct ccacttcggt       720
     tttccctatc ggcacggccg cgacatcccc gaccccgaat tcggcgcaaa gcgcaagccc       780
     gaccaactcg tggcgccgga gatggagctt ggcccccacg tggcagccct gggcatgcgc       840
     ttctacaacg gcaccatgtt ccccgaacgc tatcgcaacc agatcttcat cgccgaacac       900
     ggctcctgga accggagcga acggatcggc taccgcgtcg tcctggtgcg cctcgaaggg       960
     aaccgcgccg tctcctacga gccctttgcc gagggatggc ttgacaacga caaggtctgg      1020
     ggccggcccg ttgatgtgca ggtaatgccc gacggcagcc tgctcgtttc cgacgacaag      1080
     gccggggcca tctaccgcat cagctaccgg caacagccgc tggcccatgg cgcgcagtga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page