(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE172

CP002031.PE172       Location/Qualifiers
FT   CDS_pept        177994..178203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83038"
FT                   /protein_id="ADI83038.2"
FT                   /translation="MLDTRKTTTGSPSTERCDIKTWSGACGHDSYTAIGDKYRCDLCGT
FT                   IADLSHEVKHDTFPYTSGDYDNLS"
     atgttggaca cacgcaaaac aacaaccggc agtccgtcca cggagagatg cgacatcaag        60
     acgtggagcg gagcatgcgg acatgattcc tacacggcca tcggtgacaa ataccggtgt       120
     gatctgtgcg ggaccattgc cgacctgagc catgaagtga agcacgatac gttcccctac       180
     acgagcggcg actacgacaa cctgagttag                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page