(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE175

CP002031.PE175       Location/Qualifiers
FT   CDS_pept        181114..181881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0178"
FT                   /product="dehydrogenase molybdenum cofactor insertion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83041"
FT                   /protein_id="ADI83041.1"
FT                   /translation="MTDLELYEEIARLARLGEPFALATVVASSGSSPRKAGAKMLIRGD
FT                   GSALGTVGGGHVEQDTLAAARASLAEGAPRTLEFVLTEEHGYACGGSMSVFIEPQGRRP
FT                   LLVMFGAGHVGRAVTALAHGCGFRVVVIDERPEYAVPALLPGADEIVCAPVDAAFARLT
FT                   LDRESFAVIATPGHVHDFDAVRGCLATEVGFIGLLGSRRKREALMKALTEEGYEAVRQA
FT                   RVVTPVGLDIGAQTPEEIAVSIVGQLVKLRRQA"
     gtgaccgatc tggaattgta cgaggaaata gcccggctcg cccggctggg tgagcccttt        60
     gcgctggcaa cggtggtggc gagctcgggc tcgtcgcccc gcaaggccgg tgccaaaatg       120
     ctcattcgcg gcgacggcag cgctctgggg accgtgggcg gcgggcatgt cgagcaggac       180
     accctggcgg cggcccgagc gtccctggcg gagggggcac cccgcaccct ggagtttgtt       240
     ctgaccgaag agcacggcta cgcctgcggc ggcagcatgt cggtcttcat cgaaccccag       300
     ggccgccggc cgctgctggt catgttcggt gccggtcacg tggggagggc tgttacggcc       360
     cttgcccacg gctgcggctt tcgggtagtc gtgattgacg agcgccccga atacgccgtg       420
     ccggcgctcc taccgggggc cgatgagatc gtctgcgccc cggtcgacgc agcgttcgcg       480
     cggctgacgc ttgatcggga gagtttcgcg gtcattgcca cgccggggca tgtgcatgac       540
     ttcgatgccg tgcgggggtg cctggccacg gaagtcggat tcatcggcct gctcggcagc       600
     cgccgcaagc gtgaggcact catgaaagcc ctgacggagg agggctatga agcggtccgc       660
     caggcccggg tggtgacgcc ggtgggcctc gacatcggtg cccagacccc ggaggagatc       720
     gcggtcagta tcgtggggca gctggtgaag ctcaggaggc aggcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page