(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE182

CP002031.PE182       Location/Qualifiers
FT   CDS_pept        186988..187182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78311"
FT                   /protein_id="ADN78311.1"
FT                   /translation="MSPVCLTTKRENARRTSKAATVPPCFVFEVVSGLRLESWLDLLTA
FT                   YMSMLQIMALVCLTIYNIP"
     atgtctccgg tctgcctgac cacgaagcgg gaaaatgcaa ggcgtacgag caaggcggcc        60
     actgtgccgc cttgtttcgt tttcgaagtg gtgtcgggcc tgcggctcga gagttggtta       120
     gaccttttga ccgcatatat gtcaatgctg cagatcatgg cgcttgtgtg tcttaccatc       180
     tacaatattc catga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page