(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE183

CP002031.PE183       Location/Qualifiers
FT   CDS_pept        187306..188298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0185"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83048"
FT                   /protein_id="ADI83048.1"
FT                   /translation="MRKFGFLAVFMSLSLVLLSTAMAAPPGGKVLIGVSKIVSHPALDA
FT                   VEKGLQDELAALKINAQYDLQNANGDANTAASIANKFQSEKVTLAVGIATPTAQSLVNT
FT                   LKTTPVVFSAVTDPVKAGLVKSLAKGEKYVTGVSDMTPVKQQIELLLKIKKVKRLGHIY
FT                   TSSEENAVVLAGVVKKACQDLGIQYVETTVSKSAEVKQATQSIIRRVDALYVSTDNTVV
FT                   SAMSALTDVAMKNKVPVMSADPSSAESHPVLAAWGFDYYKMGRATGKMVAEILKGKKPE
FT                   QLPTRFMTKASDVDLLVNLDVAKKLGLTVPAAIVKSANKVVENGKLTKK"
     gtgagaaaat tcggtttctt ggctgtgttc atgtcccttt cccttgtgct gctttcgacg        60
     gccatggcgg cccctcccgg cggcaaggtc cttatcggag tgtcgaaaat cgtttcgcat       120
     ccggcccttg atgccgttga aaaggggctc caggacgagc tggccgctct gaagatcaat       180
     gcccagtacg atctgcagaa cgccaacggc gacgccaaca ccgccgcctc catcgccaat       240
     aaattccagt ccgagaaggt gaccctggcc gtggggatcg ccactcctac cgcccaatcc       300
     ctggtcaata ccctgaaaac gacgccggtg gttttttccg cagtgaccga ccccgtcaag       360
     gccggtctgg tgaaatcctt agccaagggc gagaagtacg tgaccggcgt ttccgacatg       420
     acccccgtca agcagcagat cgagctcctg ctcaagatca agaaggtgaa gcggctcggc       480
     cacatctaca ccagctccga agaaaatgcc gtggtgcttg ccggcgtggt gaagaaggcg       540
     tgccaggacc tgggcatcca gtacgtggaa accaccgtgt ccaagtccgc cgaggttaag       600
     caggccaccc agtccatcat ccgcagggtc gacgccctct acgtgagcac cgacaacacg       660
     gtggtgtcgg ccatgagcgc cctgaccgac gttgccatga agaacaaggt gccggtcatg       720
     tcggcggacc cgagctctgc cgagagccat cccgtcctgg cggcctgggg tttcgactat       780
     tacaagatgg ggcgcgccac gggcaagatg gtggccgaga ttctgaaggg caagaagccg       840
     gagcagcttc ctacccgctt catgaccaag gcttccgacg tggacctgct ggtgaacctg       900
     gacgtggcga agaagcttgg cctcaccgtg ccggccgcta tcgtgaagag cgccaacaag       960
     gttgtcgaga acggcaagct gaccaagaag taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page