(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE184

CP002031.PE184       Location/Qualifiers
FT   CDS_pept        188315..189226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0186"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83049"
FT                   /protein_id="ADI83049.1"
FT                   /translation="MIEGIFVEGLIYGIMVLGVFISFRILDFPDLTVDGSFPLGAALMA
FT                   QCIMMGVNLWLALLIAFAGGVIAGVVTSLIHNHLKVPNLLAGILTMTMLYSVNIRVLGN
FT                   RANVPLLNQETILSQVTERLTGIIPDEYILLVFFAVVTLVIKLLLDLFFRTDLGLTIGA
FT                   MGNNEQMVISQGVNPQTLKSIGLGLSNGLVALSGAFAAQYLGFADVGLGQGIIISGLAS
FT                   VMIGEFLIMKSNRIGVLTLCAVLGSICFYAVMYVGRYYGYVINMTPNDLNLIKGILIIA
FT                   LLVLTQSKKLKKFAVKAVVKND"
     atgatcgaag gtatttttgt tgaaggactc atttacggga tcatggtcct gggggtattc        60
     atctccttcc ggatcctcga ttttcccgac ctgacggtgg acgggtcgtt tcccctggga       120
     gcggccctca tggcccagtg catcatgatg ggggtaaacc tctggctggc gcttctcatc       180
     gcctttgcag ggggggtgat cgccggcgtg gtcacctccc tcatccataa ccacttgaag       240
     gtgccgaacc tcctggccgg catcctgacc atgaccatgc tctactccgt caacatccgg       300
     gtgttgggga accgggcgaa cgtcccgctc ctgaaccagg aaacgatcct ctcccaggtg       360
     accgaacggc ttacggggat catcccggac gagtatatcc tcctggtctt tttcgcggtg       420
     gtgaccctcg tgatcaaact cctgctcgac ctttttttcc gtaccgacct ggggctcacc       480
     atcggggcca tggggaacaa cgagcagatg gtcatttccc agggggtgaa tccccagacc       540
     ctgaagtcca tcggcctggg cctttccaac gggctggtgg ccctttccgg tgcctttgcg       600
     gcccagtacc tgggctttgc cgatgtgggg ctcggccagg ggatcatcat ttcgggcctg       660
     gcgtcggtca tgatcggcga gttcctgatc atgaagagca accggatcgg cgtgctcact       720
     ctctgcgccg ttctgggctc catctgtttt tacgcggtca tgtacgtggg gcgctactat       780
     ggctacgtca tcaacatgac ccccaacgac ctgaacctca tcaaggggat cctgatcatc       840
     gcgctgctgg tccttaccca gagcaagaag ctgaagaaat tcgccgttaa agccgtggtg       900
     aaaaatgatt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page