(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE186

CP002031.PE186       Location/Qualifiers
FT   CDS_pept        190058..191566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0188"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83051"
FT                   /protein_id="ADI83051.1"
FT                   /translation="MLLIHPPVAKPGEPPAGIARLAGELRAHGLHCRVLDASLEGLLWL
FT                   LEQPSPATDTWTRRASRSRADHVATLRGMDAYRSPDRYRRAVSDLNRLLAAAGRECGAV
FT                   PGLADYRQDGFSPVSSADLLRAAEEPERNPFHPWFSQRLPELLDGVRVAGLSLNYLSQA
FT                   VSAFAMIGFLRTRFPGLTLVLGGGLVTSWLRRPGWRNPFGGLVDHLVDGPGELPLLRLL
FT                   GAEEPLCRDVPPVYDPLPLHDYLSPGLVLPYSAAGGCYWNRCSFCPERAEGNAYRPRAV
FT                   QRVLADLETLVSRHQPALLHLLDNAVSPSLLQGMAAAPPGVPWYGFARVDEQLADPGFC
FT                   RTLRRSGCVMLKLGLESGDQGVLDRLHKGIDLATAARALRSLRAAGIAVYAYLLFGTPA
FT                   ETEEAARRTLAFVAEHREEIGFLNLAVFNMPISGDEADAYGTAPFYEGDLSLYTAFRHP
FT                   RGWDRKQVRRFLDREFTRHPAVAPILRRDPPVFTSNHAPFFAGG"
     atgctcctca ttcatccccc tgtcgccaaa ccgggcgaac cgcccgccgg catcgcccgc        60
     cttgcgggtg aactccgggc ccatggcctt cactgccggg tgctggatgc cagcctggag       120
     gggctcctct ggctgctgga acagccgtct ccagccaccg acacctggac ccgccgggca       180
     tcccgaagcc gtgcagatca cgtggccaca ctgcggggga tggacgccta ccgctccccc       240
     gaccggtacc gccgggcggt cagcgacctg aaccggctcc tggccgcggc ggggcgcgag       300
     tgcggcgcag tgccggggct tgcagattac cggcaggacg ggttttctcc cgtatcgagc       360
     gccgatctgc tcagggccgc ggaagagcct gagcgcaatc ccttccatcc ctggttcagt       420
     caacgcctgc ccgagctgct ggacggtgtc cgcgtggcgg gcctgtccct caactacctg       480
     agccaggcgg tttctgcctt cgccatgatc ggctttctcc gcacgcggtt ccccggactg       540
     accctggtgc tgggcggcgg gctggtcacg tcgtggctgc ggcgccctgg gtggcgcaat       600
     ccgttcggcg gcctcgtgga tcacctggtg gacgggcccg gggagctgcc ccttctgcgg       660
     cttctggggg ccgaagagcc gctctgccgt gacgtgccgc ctgtctacga cccgctgccc       720
     ctgcacgact acctttcccc cggtctggtt cttccctaca gcgccgccgg cggctgctac       780
     tggaaccgct gctccttctg tcccgagcgg gcagagggaa acgcctaccg tccccgcgcc       840
     gttcagcgag tactggccga tctggagacc ctggtcagcc ggcaccaacc cgcactgctg       900
     cacctccttg acaatgccgt cagtccgtcg ctcctgcagg ggatggcagc tgccccgccg       960
     ggcgtcccct ggtatggctt cgccagggtc gacgaacagt tggcggaccc cggtttctgc      1020
     cggaccctca ggcgctcggg atgcgtgatg ctgaagcttg ggcttgagtc gggggaccag      1080
     ggggtgctgg accggctgca caaggggatc gacttggcaa cggcggcacg ggcccttcga      1140
     agtttgcgcg cggcgggcat tgccgtgtac gcctacctcc tgttcggcac ccccgcggaa      1200
     acggaagagg ctgcccggcg gacgctggca ttcgtggctg agcaccggga ggagatcgga      1260
     ttcctcaatc tggcggtgtt caacatgccg atcagcgggg atgaggccga tgcttacggc      1320
     accgcgccgt tttacgaggg agatctctcg ctctacaccg ctttccgaca tccccggggc      1380
     tgggaccgga agcaggtgcg gcgcttcctg gaccgggagt tcacgcgcca tcccgccgtg      1440
     gcgccgattc tgcgccgaga cccgccggtg tttacctcca accatgcacc ctttttcgcc      1500
     gggggctga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page