(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE19

CP002031.PE19        Location/Qualifiers
FT   CDS_pept        complement(28903..30339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0019"
FT                   /product="helix-turn-helix transcriptional regulator with
FT                   aminotransferase domain, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82882"
FT                   /protein_id="ADI82882.1"
FT                   /translation="MNTVKSGGKIPLYESVAGRVAQLIGEGTFRAGDRIPSVRALGRQF
FT                   QVSLTTVMEAYTLLEDRGLIEARPQSGYYVRARFPGSTAEPEMTAPPLKPTTVGTAELS
FT                   MMVMRDTRNPDLVPLGAAIPNPELLPVDRLNRMLATESRKHAVASVSYDMPPGCERLRV
FT                   QIARRMLAVGCALAPDQIVTTSGCIEAVVLSLRAICRPGDTVAVESPVYYNFLQAIDLM
FT                   GLKALEIPTHPRTGISLDALRYALDHTPIRACLVVANFNNPLGSLMPDDHKRELVAMLA
FT                   ARRIPLIEDDIYGDLSFSPERPRAAKAFDEAGLVLYCTSVTKTVAPGYRVGWVAPGIFQ
FT                   KEIERLKAVTTIACSTPTELAVAEFLANGGYDHHLRRIRRIYARQMSLMAEAVGQAFPV
FT                   GTRVTRPEGGFVLWVECPERVDSLVLYEQALTRGITIAPGPIFSATGKYRNCIRLNAAW
FT                   WDDRVERAIHTLGELAAAMM"
     atgaacacgg tgaaaagcgg aggcaaaatc cctctctacg aatcggtggc cggccgcgtg        60
     gcccaactca tcggcgaggg aacattccgg gcaggggacc ggattccgtc ggtcagggca       120
     ctggggcggc aattccaggt gagcctcacc acggtgatgg aggcctacac cctcctcgag       180
     gatcgaggac tcatcgaggc gcgcccccaa tcagggtact acgtgagagc ccgcttcccc       240
     ggctcgacag ccgagccgga aatgacggcg ccgcccctga aacctacaac cgtcggcacg       300
     gcggaactct ccatgatggt aatgcgggat acccgcaacc cggacctcgt cccgctgggc       360
     gccgccattc ccaatcccga gctgctgccg gtggaccggt tgaaccggat gctcgccacc       420
     gagagccgga aacatgccgt ggccagcgtc tcctacgata tgccacccgg ctgcgagcgg       480
     ctgcgggtcc agatcgcccg gcggatgctg gccgtggggt gcgccttggc gccggaccag       540
     atcgtgacca cctccggctg tatcgaggcg gtagtcctgt cgctgcgggc catctgccgt       600
     cccggggata cggtggcagt ggaatcgccg gtgtactaca acttcctgca ggcgatcgac       660
     ctgatggggc tcaaggccct ggagatcccc acccatccgc gcacggggat cagcctcgac       720
     gccctgcgct acgcccttga tcacaccccg atccgggcct gcctggtggt cgccaacttc       780
     aacaatcccc tgggaagcct catgcccgac gaccacaagc gcgaactggt ggcaatgctg       840
     gcggcccgcc ggattcccct catcgaggac gatatctacg gcgatctgag tttctccccg       900
     gaacgccccc gggcggccaa ggccttcgac gaggcagggc tcgtcctgta ctgcacatcg       960
     gtcaccaaaa ccgttgcacc gggctaccgg gtcggctggg tggctccggg gatcttccaa      1020
     aaggagatcg agcggctcaa agcggtgacc accatcgcct gctctacgcc cacggagctt      1080
     gccgtggcgg agtttcttgc caacggcggg tatgaccacc acctgcggcg catccgcagg      1140
     atctacgccc gccagatgtc cctcatggcc gaggcggtgg ggcaggcatt cccggtcggt      1200
     acccgtgtca cccgacccga aggggggttt gtcctctggg tcgaatgccc cgagcgggtg      1260
     gactccctgg ttctctacga gcaggcgctc accaggggga tcaccattgc gccgggtcca      1320
     attttttcgg ccaccggcaa gtaccgcaac tgcatccgcc tgaacgccgc atggtgggac      1380
     gatcgggtgg aacgggccat ccataccctt ggagaactgg ccgccgccat gatgtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page