(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE190

CP002031.PE190       Location/Qualifiers
FT   CDS_pept        194685..195251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0192"
FT                   /product="nitroreductase-like family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83055"
FT                   /protein_id="ADI83055.1"
FT                   /translation="MDTLEAIRTRRSVRAFSDRPVEPEKLQTVLEAARQAPSWANMQCS
FT                   RFVVVQDAEIKAKISELSFVEAFFAPLGYRTNPAQKALAEAPVVIVACGVPGESGDLRG
FT                   QQYYMTDVGIATENLMLAAHAVGLGSVFVGVFDEEQLGDLLDIPPEIRIVGLFPLGYPR
FT                   DEAPAKSGPARKPLDEIVFQGKWKS"
     atggatactc ttgaagcaat caggacgcga cggagcgtgc gggcattttc cgaccggccg        60
     gtggagccgg aaaagcttca gacggtgctg gaggcggcac gtcaggcgcc ctcctgggcg       120
     aacatgcagt gcagccgttt cgtggtggtg caggatgccg aaatcaaggc aaagatcagc       180
     gaactgtcgt tcgtggaggc atttttcgcg ccgctcggct acaggaccaa cccggcccag       240
     aaggctctcg ccgaagcgcc ggtggtgatc gttgcctgcg gcgtgcccgg cgagtcgggc       300
     gatctgcgcg ggcagcagta ctacatgacg gacgtgggga tcgccacgga aaacctcatg       360
     ctcgctgccc atgccgtggg actcggctcg gtgtttgtcg gcgtcttcga cgaggaacag       420
     ctgggcgacc tcctggacat cccgccggag atcaggatcg tggggctttt ccccctgggc       480
     tatccccggg atgaggcccc ggcaaaatcg ggtccggcgc gcaagcccct ggatgagatc       540
     gtgttccagg gcaagtggaa atcctag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page