(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE204

CP002031.PE204       Location/Qualifiers
FT   CDS_pept        complement(207266..209041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83069"
FT                   /protein_id="ADI83069.1"
FT                   /translation="MSFTGDLEHLSIVDVIQLLHATRKSGTLTVRGRKGESQLVFNDGY
FT                   IISANHFDNSVRIGNILVEAGVISKEVLEQALQEQEEAGAGRKPLVATLLERGSVRKED
FT                   AYRGLEALIELTVVEILTWRRGTFDLDVNRVSVSDEYRYFPEKLHEEITLHTENVLMDA
FT                   LRIYDEKKRDGLLVEEEFAIEAPIPDLSGDEAADFNISADDLGLGDLDQIERKIPQVFL
FT                   GLEDRSPSLQRKIQELGADLSDKEQEELFAFLGRLGNTAPAAGAPTLSAILFSPDDLFS
FT                   YCVTTVCRQAGISVFTTNDEQDLAPLAQQFASRGGQTTLILDSPASPGFTLPAEDAARL
FT                   LRRVREHHPSLALIQLASPLEPAFALQALKDGAVAVFPRPVREVSGDTFLEDTLRLLDA
FT                   LPLYLRRRGSDGGEAAMAQLGKTLMELRALREPPEIALTLLSTVAGTFERALTLIVREE
FT                   ELIAERSIGIRSPRGACVSPSFGTRIPLDRPSVLRDAIEKRAAFYGETDDEILKGHLFP
FT                   IIGAPLHPTVILLPLVCGGKVIALIYGDFGHKGAAPVRTELLELVTGEAGLVLETALYR
FT                   RKRERKAPEGTACDR"
     atgtctttca ccggtgacct ggaacacctg tcgatcgtcg acgtcatcca actgctgcac        60
     gccacccgca agtcaggcac cctcaccgtg cggggacgca agggagagtc ccagctcgtc       120
     ttcaacgacg gctacatcat cagcgccaat cacttcgaca acagcgtccg gatcggcaac       180
     atcctcgtag aggccggcgt catcagcaag gaggtcctgg agcaggccct gcaggagcag       240
     gaggaggcgg gagcgggacg gaaacccctg gtggcaacac ttctcgaacg gggcagcgtc       300
     cgcaaggagg acgcctaccg ggggcttgag gccctcatcg agctgacggt ggtggaaatt       360
     ctcacctgga ggcggggcac ctttgatctg gacgtgaacc gggtcagcgt ctccgacgag       420
     taccgctatt tcccggaaaa gctccatgag gaaatcacgc tccacacgga aaatgtcctc       480
     atggacgccc tccgcatcta cgacgagaaa aagcgcgatg gtctgctggt ggaggaggag       540
     tttgcgatcg aggcccctat cccggacctc tccggcgatg aagccgccga tttcaacatc       600
     tcggccgacg atctgggact cggggacctg gatcagatcg aacggaaaat tccccaggtc       660
     tttctggggc tggaggatcg cagcccctcc cttcagcgta agattcaaga gctgggcgca       720
     gacctttccg acaaagaaca ggaggagctc ttcgcctttc tgggccggct cgggaacacc       780
     gcaccagccg ccggtgcgcc cactctttcc gccatcctct tcagcccgga cgaccttttt       840
     tcctactgcg taaccaccgt ctgccgtcag gcggggattt ccgttttcac caccaacgac       900
     gagcaggacc tggcccctct ggcgcaacag ttcgcctccc gtggcgggca gacgaccctg       960
     atccttgact cgccggcatc gcccggcttt accctgcccg cagaagatgc ggcgcggctc      1020
     ctgcgacgag tcagggagca ccacccctcc ctcgccctca tccagctcgc ttcgcccctt      1080
     gagccggcct ttgccctcca ggccctgaaa gacggagccg tggccgtctt cccccgcccc      1140
     gtgcgcgagg tgagcggcga caccttcctg gaggacaccc tccggcttct ggacgccctg      1200
     cccctctatc tgaggcggcg gggctcagac ggcggcgaag cggccatggc ccaactcggc      1260
     aaaacgttaa tggagttgcg ggcacttcgc gagcctccgg aaatcgccct gaccctcctg      1320
     agtacggtgg caggcacctt cgagcgggca ctcactctca tcgtgcgcga agaggaactt      1380
     atcgccgagc ggagtatcgg cattcggagc ccccgtggcg cctgcgtctc accctctttc      1440
     gggacgagga tccccctgga ccgcccgtcg gtgctccggg acgcgattga aaaaagagct      1500
     gcattttatg gcgaaactga cgatgagata ctgaaggggc atctttttcc catcatcggc      1560
     gctccgctcc accccacggt catcctgctc ccgctggtct gcggcggcaa ggtcatcgct      1620
     ctcatctacg gggatttcgg ccacaagggg gcagcgcccg tgcgcaccga gctgcttgag      1680
     ctcgtgacgg gcgaggcggg gttggttctg gaaacggcgc tctatcgcag gaaacgggag      1740
     cggaaggctc ccgaggggac ggcctgtgac cgctga                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page