(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE213

CP002031.PE213       Location/Qualifiers
FT   CDS_pept        complement(216770..218062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0215"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83078"
FT                   /protein_id="ADI83078.1"
FT                   /translation="MKILFVAPGWPRGRLWGELGFKFPSLALAALAAVTPPEWDAALCD
FT                   ESRETIDFNAPCDLVAITAMTPQAPRAYEIAAGFRARGKTVVMGGFHASNLPDEALGHV
FT                   DAVVVGEGELSWPLLLADFQAGRLQRLYRSPGLLPMASIPVARREIFAGKGYLLTNTLQ
FT                   TTRGCPFDCEFCSVTAFYGRKYRERPVEAVLAELETLRKANSFAFFVDDNLVADRRYAL
FT                   PLFRGMKGMGFKWLSHAPIDFAGDEELMRAAGESGCIGMFVGFESLDQEALAAMGKVTN
FT                   SSSAFLDQARKFRDHGIGILGSFVLGYDGDTPDSFGRILRFCEEARIEAAIFPILTPYP
FT                   GTAVRRRLEAEGRITSNDWRDYDMGHVTFRPTGMTARELQDGHDWLNRSFYSFGSMWRR
FT                   IGKLHRSVQVFGPMNLGFRSAIRKSDKTKAS"
     atgaagattc tcttcgtggc gccgggctgg ccccggggca ggctctgggg cgaactgggc        60
     ttcaagttcc cgtcccttgc cctggccgcc ctggctgcgg ttactccgcc cgagtgggac       120
     gcggccctct gcgacgagag ccgggagacc atcgacttca atgccccgtg cgatctggtg       180
     gccatcaccg ccatgacccc ccaggcgccc cgggcctacg agatcgccgc cggcttccgc       240
     gcccggggaa aaaccgtcgt catgggggga ttccacgcca gcaatctccc ggacgaggcc       300
     ctcggccacg tggacgccgt ggtggtgggc gaaggggaac tctcctggcc cctgctgctg       360
     gcggatttcc aggcgggccg gctccagcgc ctctaccggt ccccggggct cctgcccatg       420
     gcatcgatcc cggtggcccg gcgcgagatc ttcgccggca aggggtatct gctgaccaac       480
     accctccaga ccacccgggg ttgccccttt gactgcgaat tctgctcggt caccgctttt       540
     tacggccgca agtaccggga gcgccccgtc gaagcggtgc tggccgagct ggaaaccctg       600
     cgcaaggcca attcctttgc ctttttcgtg gacgacaacc tggtggccga ccgccgctac       660
     gccctgcccc tgttccgggg gatgaaggga atgggattca agtggctctc ccatgccccc       720
     atcgatttcg ccggtgatga ggagttgatg cgggccgccg gcgaatcggg ctgcatcggc       780
     atgttcgtgg gattcgagtc cctggaccag gaggccctgg ccgccatggg aaaggtgacc       840
     aacagctcct ccgcgttcct ggaccaggcc cggaaattcc gggaccacgg catcggcatc       900
     ctcgggtcct ttgtcctggg ctacgacggc gacaccccgg actccttcgg acgcatcctc       960
     cgcttctgcg aagaggcccg gatcgaggcg gccatcttcc cgatcctcac cccctacccc      1020
     ggtaccgccg tacgccggcg gctggaggcc gaggggcgga tcacctccaa cgactggcgc      1080
     gactacgaca tggggcacgt gaccttccgc cccacgggaa tgaccgcccg ggagctccag      1140
     gatgggcacg actggctcaa ccgctccttc tactccttcg gctccatgtg gcggcgcatc      1200
     ggcaagctgc accgctcggt acaggtcttc ggccccatga acctggggtt ccgcagcgcc      1260
     atccgaaaat ccgacaaaac gaaagcctcc tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page