(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE216

CP002031.PE216       Location/Qualifiers
FT   CDS_pept        complement(219312..220688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0218"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83081"
FT                   /protein_id="ADI83081.1"
FT                   /translation="MLQSLKNYTTEKIVSLLLSMATNASNENLARMTHLMELIPKKEYY
FT                   KERIRWIRRLIRENHPSIEFPRRILREIHPNQREKWITNLAVNHLLSGTNKRKAWQERE
FT                   GYYPPSTVVISTTMKCNLSCYGCYAGDYAKALELTNDEIDSILTQMKEMGVYFAVISGG
FT                   EPFFKEDIFEIFKKHSDMAFLVFTHGGLIDEAMVRKLVEVGNVMPAFSLEGYEQETDER
FT                   RGPGHFRKVMRAMDLLREAGLSFCGSFTQTSRNTDIITSDEYIDMLVAKGVFALWLFTY
FT                   VPVGREPDLELMATPEQRDALRRRIVDFRAAKPMLFVDFWNDGPIISGCIAGGRKYFHI
FT                   NANGDIEPCVFCHFAVDNIRRTTLREALRSPLFRKIRQVQGEHDNLLRPCMLIDHPDVG
FT                   RELFQSAGAYPTHEGADAIFTALADNMDDYARRYAEFADPAWEQEFGAGQGKRPKGVTR
FT                   "
     atgctccaga gcctgaaaaa ctatacaacc gaaaagatcg tctccctcct tctctccatg        60
     gccaccaacg cctccaacga gaacctggcg cggatgacgc acctgatgga gctgatcccg       120
     aagaaggaat actacaagga acggatccgc tggatccgga ggctcatccg ggagaaccat       180
     ccttccatcg agtttccccg ccgtatcctg cgggagatcc accccaacca gcgggagaag       240
     tggatcacga acctggcggt gaaccacctc ctctcaggca ccaacaagcg gaaggcgtgg       300
     caggagcggg aggggtacta tcccccctcc accgtggtca tcagcaccac catgaagtgc       360
     aacctctcct gttacggctg ctacgcgggc gattacgcca aggccctgga gctgaccaac       420
     gacgagatcg attcgatcct cacccagatg aaggagatgg gggtttactt cgccgtcatt       480
     tccggcggtg agccgttctt taaagaagac atcttcgaga tcttcaaaaa gcactcggac       540
     atggccttcc tcgtcttcac ccacggcggg ctcatcgacg aggccatggt acggaaactg       600
     gtggaggtgg ggaacgtgat gcccgccttc tccctggagg ggtacgagca ggaaaccgac       660
     gaacggcgcg gccccggcca tttccgcaag gtcatgcggg ccatggacct gctgcgggag       720
     gcggggctct cgttctgcgg ctccttcacc cagaccagcc ggaataccga catcatcacc       780
     agcgacgagt acatcgacat gctggtggcg aagggggtct tcgccctctg gctcttcacc       840
     tacgtgccgg tgggacggga gcccgatctg gaactgatgg cgacaccgga gcagcgggac       900
     gccctgcggc gccggatcgt cgatttccgg gccgccaagc cgatgctctt cgtggacttc       960
     tggaacgacg gacccatcat cagcggctgc atcgcggggg ggcgcaagta cttccacatc      1020
     aacgccaacg gcgacatcga gccgtgcgtt ttctgccact tcgccgtgga caacatccgg      1080
     cgcaccaccc tgcgggaggc cctgcggtcg ccgctgttcc ggaaaatccg ccaagtgcag      1140
     ggcgagcacg acaacctgct ccgcccctgc atgctcatcg accaccctga cgtggggcgc      1200
     gagctcttcc aaagcgccgg ggcctatccc acccacgagg gggccgacgc catcttcacc      1260
     gctctggcgg acaacatgga cgactatgcc cggcggtacg ccgagttcgc cgacccggcc      1320
     tgggagcagg agttcggcgc cgggcagggg aaacggccca agggcgtaac ccgctga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page