(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE219

CP002031.PE219       Location/Qualifiers
FT   CDS_pept        222398..223861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0221"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83084"
FT                   /protein_id="ADI83084.1"
FT                   /translation="MNILLLRPHPGNDRFGLGPFFRVEPLGLEYIGAALRAHGHTVSAA
FT                   DLRFRPGAATWVRRTRPRLVGISCLHALEYERVVETAREVRRASPDAFIFVGGHAAAAF
FT                   PAPLECDAVDAICRDDGEEIVPLVAAALAKGGRLDEVPGLRLREPDGWRDTPCLDRQTC
FT                   LDLVPLPARDLVDRHRSGYHCLLFKPVWLVETARGCPHRCSFCSVWQLYGRSCRERSIA
FT                   AVVEDFATAGDSIFVADDLFWHNPARSLELADALKKRRIFKRWILVQTRTDLICRSADL
FT                   MAAWRPLAKDFDIFLGLEAATDKGLAGITKDSGVAESVEAVRLARELRYGINGNFLIDP
FT                   DWDEDDFRDLWGFVARYGLQRAGFTILTPLPGTDFFREVAPRIARQPWSNFDMHHLLWD
FT                   PRVGAPRFFELYAETWRRSILNTSGDKSLVDWMKQVRPSQIPYIARVLWRTQRMMKPEA
FT                   YLREYEATRPRTTEPLVDFSAGACCGGAA"
     atgaacattc tcctgctccg cccccatccc ggcaacgacc ggttcggtct cggccccttc        60
     ttcagggtcg agcccttggg gctcgaatat atcggcgcgg cactccgtgc ccacggccac       120
     acggtcagcg cggcagacct ccgtttccgc cccggcgccg caacctgggt caggcgcacc       180
     cggccccgtc tcgtgggaat atcctgcctc cacgccctgg agtacgagcg ggtggttgaa       240
     acggcccggg aggtcaggcg ggcgagcccc gatgccttca tcttcgtggg gggacatgcg       300
     gccgccgcct ttcccgctcc tctggagtgc gacgcggtgg acgccatttg ccgcgacgac       360
     ggggaggaga tcgtgcccct tgttgccgcc gccctggcga agggtgggcg gcttgacgag       420
     gtgccggggc tccggctgcg cgaacccgac ggctggcgcg acaccccctg cctcgaccgc       480
     cagacctgcc tcgacctcgt gccgctcccg gcccgcgacc tggtggaccg gcaccgctcc       540
     ggctaccact gcctactctt caagccggtc tggctcgtgg agacggcccg gggctgcccc       600
     caccgctgct ccttctgctc cgtctggcag ctctacggcc gttcctgtcg cgagcggagc       660
     atcgccgcag tggtggaaga tttcgccacg gccggggact cgatcttcgt ggccgacgac       720
     ctcttctggc acaatccggc ccggagcctg gaactggccg acgcgctgaa aaagcgcagg       780
     attttcaaac gctggattct cgtccagacc cgcaccgacc tcatctgccg gagcgccgat       840
     ctcatggccg cctggcgccc gctggccaag gatttcgaca tctttctggg gctggaggcg       900
     gccaccgaca agggtctcgc cgggatcacc aaggattccg gcgtggccga gagcgtggag       960
     gcggtccgcc tcgcccggga gctgcgctac ggcatcaacg gcaatttcct catcgatccg      1020
     gattgggatg aggacgattt ccgcgacctc tggggctttg tggcccgcta cggcctccag      1080
     cgggccgggt tcacgatcct cacgcccctg cccggcaccg atttcttccg ggaagtggcc      1140
     ccgcgcattg cccgccagcc ctggtccaac ttcgacatgc accacctcct gtgggacccc      1200
     cgggtaggcg ccccgcgttt cttcgagctc tatgccgaga cctggcgccg ctccatcctc      1260
     aatacctcgg gagacaagag cctggtggac tggatgaagc aggtccgccc ctcccagatt      1320
     ccctacatcg cccgggtcct ctggcggacc cagcggatga tgaagcccga ggcctatctc      1380
     agggagtacg aggcgacccg gccccggaca acggagcccc tggtggattt cagcgccggg      1440
     gcgtgctgcg ggggagccgc ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page