(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE220

CP002031.PE220       Location/Qualifiers
FT   CDS_pept        223861..225147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0222"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83085"
FT                   /protein_id="ADI83085.1"
FT                   /translation="MSRSPRLLLIYPATHKLGWARYFQLPSHSLQMVAAATPRHWEVIL
FT                   ADEVHDEVPFDGTFDLVGITAMTHQATRAYEIADRFRARGVPVVMGGIHPTVLPDEALE
FT                   HADAVVVGEAEPVWAHLLDDLLAGRLAPVYRAPVPTDEILSAPWPRREILAGRRYLTTQ
FT                   TVQASRGCPYDCSFCTVTPYFGRTFRYRDPDDILAEIRSFRRKLVVFLDDNLLGDPIKA
FT                   RPILRGLAEMDVRWGSQTNLRFAEDPELLKLVADSGCIGLFVGIESVTGSHANMAKSGT
FT                   RYSQTDLMKRVRDAGIILETSIIFGFDDHDESVFETTLRFLEECSPSVPTFHILTPYPG
FT                   TALFRQFQEEGRLLTTDWSRYDHSTVVFRPRLMSPERLHRGWLEARREAYSWRAIATRV
FT                   MRNPGRRLTNLAYNMLRKGPNDLLEDGAP"
     atgtcccgtt cccctcggct gctgctgatc tacccggcga cccacaagct cggctgggcg        60
     cgctattttc agcttccctc ccattcgctc cagatggtgg ccgcggccac gccccgccac       120
     tgggaggtga tcctggccga cgaggttcat gacgaggtcc cctttgacgg aaccttcgac       180
     ctggtgggga tcacggccat gacccaccag gcgacgcggg cctatgagat cgccgaccgg       240
     ttccgggccc ggggtgtccc cgtggtgatg gggggaatcc accccacggt cctgcccgac       300
     gaggcactgg agcacgccga cgcggtggtg gtgggggagg ccgagccggt ctgggcgcac       360
     cttctcgacg acctcctggc cgggcggctc gcaccggtct accgggcgcc ggtccccacg       420
     gacgaaatcc tctccgcccc ctggccccgc cgcgagatcc tggccggccg ccgctacctc       480
     accacccaga cggtccaggc gagccggggc tgcccctacg actgctcctt ctgcaccgtc       540
     actccctact tcggccgcac cttccgctac cgcgaccccg acgacatcct ggccgaaatc       600
     cgctccttca gacgcaagct cgtggtcttt ctcgacgata acctcctggg cgacccgatc       660
     aaggcccggc ccattctgcg ggggttggcc gagatggacg tccgctgggg ctcccagacc       720
     aatctccgtt ttgccgagga ccccgagctc ctgaaactcg tggcggactc ggggtgcatc       780
     ggcctcttcg tggggatcga gtcggtgacc ggatcccacg ccaacatggc caagtccggc       840
     acccgttact cccagaccga tctcatgaag cgggtccgcg acgcgggcat catcctggaa       900
     acctccatca tcttcggttt cgacgaccac gacgagagcg tcttcgagac cacgctccgc       960
     ttcctggagg agtgctcccc cagcgtcccc accttccaca tcctcacccc ctaccccggc      1020
     acggcactgt tccgccagtt ccaggaggag gggcggctcc tgaccaccga ctggtcccgt      1080
     tacgatcact ccaccgtggt cttccggccc cgtctcatgt ctcccgaacg gctccaccgg      1140
     ggctggctgg aggcacgccg tgaggcctac tcctggcggg ccatcgccac ccgcgtcatg      1200
     cgcaatccgg ggcgccgcct gacgaatctc gcctacaaca tgctgcgcaa gggaccaaac      1260
     gacctgctgg aggatggggc gccgtag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page