(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE221

CP002031.PE221       Location/Qualifiers
FT   CDS_pept        225208..226185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0223"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83086"
FT                   /protein_id="ADI83086.1"
FT                   /translation="MTRLIVFGILAAFFFSSTFVFNRAMSLEGGHWAWTASLRYGYMLL
FT                   LLCTWLLLKGRRGVVVAAWDAFRRNWLFWTTAGSVGFGAFYALISFSASFAPGWVVATT
FT                   WQITILATPVVLLLFGRRVPARGVLFTAMIFLGIVLVTLEQATAAPLGDILRGIVPVVA
FT                   AAFAYPLGNQMVWEARHGTSSLLPAITDPVVDDSFGRVLLMVLGSIPFWVVLLIVAAPP
FT                   PPSPGQLVNTALVAVFSGVIATSLFLHARHCASTTYELAAIDATQSTEVIFSLLGEIVF
FT                   LHGLLPGSSGTAGLVLVVGGLMLYVRAQTAGQLKEKIHSRAEKG"
     atgacccgtt tgattgtctt cggaatcctt gcggcatttt tcttcagcag cacgttcgtg        60
     ttcaaccggg ccatgagctt ggagggaggg cactgggcat ggaccgcgag cctgcgctac       120
     ggatacatgt tgcttctgct ctgcacctgg ctgctgctga aaggacgacg gggggtggtg       180
     gttgctgcat gggacgcctt tcgccggaat tggctgttct ggaccacagc gggaagtgtc       240
     ggctttgggg cgttttacgc cctgatctcc ttcagcgcgt cgttcgctcc cggctgggtg       300
     gtggcaacca cctggcagat taccatcctc gcgacaccgg tggtgctcct gctgttcggc       360
     cgccgggtgc cggccagggg ggtgttgttc actgccatga tttttctcgg cattgtgctg       420
     gttacccttg agcaggcaac cgccgctccg ctgggcgaca tcctgcgggg gatagtgccg       480
     gttgtggccg cggcattcgc ctatcccctg ggcaaccaga tggtgtggga ggcccgccat       540
     ggaacatctt ctctgctgcc ggccataacg gacccggtcg tcgacgacag cttcgggagg       600
     gtactgctca tggtgctcgg ctcgattccc ttctgggtcg tgctgctcat cgtggcagcg       660
     cctccgccgc cgtcacccgg ccaactggtc aacacggcct tagtggcagt gttttccggc       720
     gtcatcgcca cgagcctgtt tctccatgcc cggcattgtg cgtcgactac ctacgaactt       780
     gccgccattg atgcgaccca atcgaccgag gttatttttt cgcttctcgg agagatcgtc       840
     tttctccatg gcctactgcc gggctcgtcg ggcaccgcgg ggctggtgct ggtcgtcggc       900
     gggctcatgc tgtatgtccg ggcccagacg gcgggtcagc ttaaagaaaa gattcacagc       960
     cgggcagaga aagggtaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page