(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE222

CP002031.PE222       Location/Qualifiers
FT   CDS_pept        226227..226667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0224"
FT                   /product="protein of unknown function DUF2721"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83087"
FT                   /protein_id="ADI83087.1"
FT                   /translation="MQPEPVVSNIAHVIQMSVAPVFLLTGVGAILSVLINRLGRIVDRA
FT                   RVIEQHLADVASDGRALARLELTTLGRRMRLINWAISSCTISALLVCVVIALLFVGAFL
FT                   HVNVSDVAALLFVFAMLALIGGLLGFLREIYLAIATARLGMR"
     atgcagccag agcccgtcgt ttcgaacatt gcccatgtca tccagatgtc cgtcgcgccg        60
     gtttttctcc tcaccggtgt cggcgcgatt ctgtccgtgc tcatcaatcg gctgggccgc       120
     atcgttgacc gtgcccgcgt catcgaacag caccttgccg atgtcgccag cgatggcagg       180
     gccttggcca ggcttgaact gacaacgctc ggtcgccgca tgcggctgat caactgggcc       240
     atcagttcgt gcacgataag cgcgctcctc gtgtgcgtgg tcatagccct gctttttgtg       300
     ggagcgttcc tccacgtcaa tgtgtcggac gttgccgccc tgctgttcgt gtttgccatg       360
     ctcgcactga tcggaggctt gctgggtttt ctccgggaga tctacctggc gatcgccact       420
     gcacgcctgg ggatgcgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page