(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE223

CP002031.PE223       Location/Qualifiers
FT   CDS_pept        complement(226858..227037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78312"
FT                   /protein_id="ADN78312.1"
FT                   /translation="MRGDSTPTVTVTAEATVREAAGAVRTEPLNLVAEARVEKDCLEYR
FT                   LSRDQESPSQFAIC"
     atgagaggag actcaacacc aaccgtaaca gttaccgcag aggcgacagt gagggaggct        60
     gccggcgctg tcaggaccga gcccctgaat ctagtggcag aagcgcgcgt ggagaaagac       120
     tgcctggagt atcgtctgtc tcgggaccaa gagtccccga gccagttcgc catctgctag       180
//

If you have problems or comments...

PBIL Back to PBIL home page