(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE224

CP002031.PE224       Location/Qualifiers
FT   CDS_pept        227485..229977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0225"
FT                   /product="sensor histidine kinase, PAS, GAF, PAS and PAS
FT                   domain-containing"
FT                   /note="domains: PAS, GAF, PAS, PAS, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83088"
FT                   /protein_id="ADI83088.2"
FT                   /translation="MIHRYLQHSPFPVLLVEPQGHIVQASPASLEFLGIDSRHSAPRAL
FT                   VDIMHAEQCEAVLRTGAALTDTGFWEGECSLLGRDEQPVRAFLRVARADDDRLVIYLRD
FT                   SAGRRRSEELLRIRLQLSERARCESLDELLRSALDAAERLTDSSIGYLHVVAPGREQAS
FT                   LQAWSSNTLTTMCRVRGGKEHHPARRVGIWGDCCRERTAVIHNDYAGLPHKKELPEGHP
FT                   PIVRVMGVPIIHGDKVLAIIGVGNKTTEYTREDAAALHELASMIMDLVERKQAEAQLLA
FT                   SEKRFRTVFEQAAVGVALVDPLTGRFVRVNAKYGDIVGYSPETMLTMGFQELTHPDDLA
FT                   VDLECISRLLKGEIRTFTREKRYLHRDGCNVWVRLTVSPLWADGEEPSFNIAIVEDITA
FT                   RKAAEAALREAKEQLELRVRERTADLEQANRALQEEVAARSQAEESLRASESRFRRLVQ
FT                   MAPLPLCFADANGTLRYVNDRFTRLFGYAPEDIPMQEEWWSRICPDGRCRGETVDSWQA
FT                   SVQRVPHGAGDIEPAEFRVECKNGDIRLVEVSGITIEGTVLATFIDITERRLAEDELHR
FT                   HRELLEELVHQRTAELKLRNMELATEIAERRRAEAALRCYTRRLTEMEEDLRKKLAAEL
FT                   HDEIGRDLTALNLNFTVIGNLAVQGPDGGLRARIEDTERLIEDISRTVRGLTAKLRPPV
FT                   LDDYGLPAALRWHADLFSRRTGIDVAVQVADSIPRMPAEKEIALFRIVQEALTNCSKHA
FT                   NAGNVKVSLDHGDGRVRLSVVDDGTGFAIESASPTPAGSGWGLTIMRERAELIGGTFRL
FT                   DTAPGKGTVLTVEIDEDS"
     gtgattcatc ggtatcttca acattcaccg tttcccgttc tactggtaga accgcaggga        60
     cacattgtgc aagccagccc ggcaagcctt gaattcctgg ggatcgactc gcggcactcc       120
     gccccccgcg ctctggtcga catcatgcac gcggaacagt gcgaagccgt gcttcgcacc       180
     ggagccgcct tgaccgacac cgggttttgg gaaggagaat gttctttgct cgggcgggat       240
     gagcagcccg tccgggcgtt cctccgggtt gccagggccg atgatgaccg cttggtgatt       300
     tacctccggg actctgccgg gcgcaggcgt tccgaagagt tgctgcgcat ccgtttgcag       360
     ctgtcggaac gtgcccggtg tgaaagcctc gacgagttac tccggtcggc cctggatgcc       420
     gctgaacggc tgaccgacag cagtatcggc tacctccatg ttgttgctcc gggccgggag       480
     caggcttccc tgcaggcgtg gtcgagcaat accctgacca ccatgtgccg ggtgaggggc       540
     ggaaaagagc atcatccggc cagacgggtc gggatctggg gcgattgctg tcgcgaacgt       600
     accgccgtga tccataacga ttacgccggg cttccgcata aaaaggaact gcccgaggga       660
     catcctccca ttgtgcgggt gatgggcgtg ccaatcattc atggggacaa ggtgctcgcc       720
     attatcggcg tgggcaacaa aacgacggag tatacccgtg aagatgcagc tgcgctgcat       780
     gaactcgcct cgatgatcat ggacctggtg gagcgcaagc aagctgaagc acagctgctc       840
     gcgagcgaaa agcgattcag gacggtcttt gagcaggcgg cagtcggggt ggccctggtt       900
     gatccgctga cgggccggtt cgtcagggtc aatgcgaaat acggcgacat cgtcggctac       960
     tctcccgaga caatgctgac gatggggttc caggagctca cccaccccga cgatctggcg      1020
     gtcgacctgg agtgcatctc ccggctcttg aagggggaaa tccgtacctt tacgagagag      1080
     aagcgttacc tgcaccggga cggctgcaac gtgtgggtca gactgaccgt ctctcccctg      1140
     tgggcggacg gcgaggagcc gagcttcaac atcgccatcg tggaagacat aaccgcccgc      1200
     aaggcggcgg aggcggccct ccgggaagcg aaggaacagc tggagcttcg cgtcagggaa      1260
     aggactgcgg atctggaaca ggccaaccgg gccttgcagg aggaggtagc cgcacgcagc      1320
     caggccgagg aatctcttcg tgcaagcgag tcaaggttca ggcgtctcgt ccagatggca      1380
     cccctgccac tgtgcttcgc ggatgcgaac ggcaccttgc ggtacgtaaa cgatcggttc      1440
     acccggctgt tcggctatgc gccggaagac attccaatgc aggaggagtg gtggagccgg      1500
     atttgccccg atgggcgctg ccgaggggag acggtcgatt cctggcaggc gtccgtgcaa      1560
     agagtcccgc acggcgcggg tgatatcgaa cccgctgaat tccgggtcga gtgcaagaat      1620
     ggtgatattc gtctggtgga agtttccggg ataacgattg agggcacggt cctggcgaca      1680
     ttcatcgata tcaccgaacg ccggttggcg gaggatgagc ttcatcgcca cagggaactg      1740
     cttgaggagt tggttcacca gcggactgcg gaactgaaac tgcggaacat ggagctggcc      1800
     accgaaattg ccgaacgccg gcgggccgag gcagccctcc gctgctacac ccggcgcctc      1860
     accgagatgg aagaggacct gaggaagaag ctcgccgccg aactgcacga cgagatcggg      1920
     agggatctga ccgccctcaa tctcaacttt accgttatcg gcaaccttgc cgtgcagggc      1980
     ccggacgggg gtctcagggc gaggatcgaa gacacggaac ggcttatcga agacataagc      2040
     cgcacggtcc ggggcctaac ggccaaactg cggccgcccg tgctggacga ctacggtctg      2100
     ccggcggcgc tacgctggca tgccgatctt ttttcacggc ggaccgggat tgatgtggcg      2160
     gtgcaggttg ccgacagcat tccccggatg ccggcggaaa aagaaatagc gcttttccgt      2220
     atcgttcagg aggccctcac gaattgttcg aaacatgcaa atgcagggaa cgtgaaggtt      2280
     tccctggatc acggcgatgg gcgggtgcgg ctttcggttg tggacgacgg cactggattt      2340
     gcaattgaaa gtgcctcgcc gacaccggcg ggaagcggct gggggctgac aatcatgcgc      2400
     gagcgggctg aactgatcgg cgggacgttc cggctggata ccgcgccggg caaaggtacg      2460
     gtactgactg ttgaaattga cgaggattcg tag                                   2493
//

If you have problems or comments...

PBIL Back to PBIL home page