(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE233

CP002031.PE233       Location/Qualifiers
FT   CDS_pept        complement(237269..237664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83097"
FT                   /protein_id="ADI83097.2"
FT                   /translation="MAHNFNLYQPATMYYGPHMQTGLKKFSGTPLRITVIATIFVVLAL
FT                   NGVASSGFLEHGGSLQPKCAISKSQSATAHSTTLKHVQIVVLGQRLFEFHSPVSFLLNG
FT                   HQDPRPQTSLTASIVFTRAPPARSSLS"
     ttggcgcata actttaactt gtatcagccg gcaactatgt actatggtcc tcatatgcaa        60
     acagggctga aaaaattctc gggaacaccc ctgcgaatta cggtgatcgc cacgatcttc       120
     gttgttctcg ccctcaacgg ggtcgccagc tccggttttc tggagcatgg cggctccctc       180
     cagccgaagt gcgccatcag caagtcacag agcgctacgg cccattcgac gaccctcaag       240
     catgtccaga tcgtagtcct cggccagcgg ctcttcgagt ttcacagccc ggtgtccttc       300
     cttttgaacg gccatcagga cccccgccca cagacatccc ttaccgcatc gatcgttttc       360
     acccgggccc cacccgcccg cagcagtctt tcatag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page