(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE237

CP002031.PE237       Location/Qualifiers
FT   CDS_pept        241631..242377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0239"
FT                   /product="helix-turn-helix transcriptional regulator, UTRA
FT                   domain-containing, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83102"
FT                   /protein_id="ADI83102.1"
FT                   /translation="MLDPHSRMPLYHQIESHLREVIRSGKWQAGEAIPPERLLIEQYGV
FT                   SRITIRQALANLVAAGLLYRKHGRGTFVAGAKERPITESLANLTGHLEELQLRGLDPRV
FT                   RVLALETRPMIAEVAEALQRSPGAEGWYLYRIVTVEQQPLMLSTVWLPCDLGVELNEEL
FT                   LKQHGMALLLTHNGIAPLRGSQRIGAMSAGPEEARLLGVRAGEAVLRVSRVIHGAADRP
FT                   LVWFRTLYRSDRYEYEVELKRGRPHA"
     gtgctggacc cgcacagtcg catgccgttg tatcatcaaa tcgagagtca tctccgggag        60
     gtcatcagga gcggcaagtg gcaggccggc gaagcgattc ctcccgaaag gctgctgatc       120
     gagcagtacg gggtcagccg gatcacgatc cgccaggccc tggcaaatct cgtggctgcc       180
     gggctgctct accgaaagca cgggcggggg acttttgtgg ccggcgcaaa agagcggccc       240
     ataaccgagt cgctggccaa cctgacgggc cacctggaag agttgcagct gcgcggactt       300
     gatccccggg tcagggtgct ggcgctggag acccgaccca tgatcgccga agtggctgag       360
     gccctgcagc gaagtcccgg cgccgaaggg tggtacctgt accggatcgt cactgtggag       420
     cagcagccgc tcatgctttc gaccgtgtgg cttccctgcg accttggggt agagctgaac       480
     gaggaactcc tgaaacagca cggcatggcc ctgctgctga cccacaacgg catcgctcct       540
     ctacgcggca gccagcggat cggcgccatg agtgccggac cggaagaggc gcgcctgctg       600
     ggggtgcggg ccggtgaagc ggtcttgcgt gtcagcaggg tcatccacgg cgctgccgac       660
     cgtccgctcg tgtggttcag gacgctctac cgctctgatc gctacgaata cgaagtcgaa       720
     ctgaagagag gcaggccgca cgcatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page