(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE238

CP002031.PE238       Location/Qualifiers
FT   CDS_pept        242374..243207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0240"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83103"
FT                   /protein_id="ADI83103.1"
FT                   /translation="MIMTTLEIFLIAITAGVAGAILGLGGGIIIVPALTLLFGIPIRTA
FT                   VAASTVSIIATSTGAAVAYLNDRLSNVRVAMWLEMGTATGALTGALVAGYLNQRVLFLM
FT                   FGVLLAYSGYNMFKARKAELPGEVLPDKVSQRLGLAGSYHDHVLNARVDYQVTRSILGL
FT                   IIMYFSGAAAGLMGIGAGIFKVPAMDQVMRMPFKASTATSNFMIGVTAASGAVVYFVRG
FT                   DVNPLITGPVVLGVLLGALVGARLMVRMKTTTIRKLFIPLIIYTAVMMMYKGVSP"
     atgatcatga ccacgctgga aatattcctg attgcaataa cggccggcgt tgccggcgcc        60
     atcctgggcc tgggcggggg aatcatcatc gtgccggccc tgaccctgct gttcggcata       120
     ccgatacgca cagccgtggc ggcatcgacg gtgtccatca ttgccacttc gaccggtgcg       180
     gcggtggcct acctgaacga ccggctgtcc aatgtgaggg tcgccatgtg gctggagatg       240
     gggaccgcca ccggcgcgct gaccggggcg ctggtggccg gctacctcaa ccagcgcgtg       300
     ctgttcctga tgtttggcgt gctgctggcc tattccggct acaacatgtt caaggcccgc       360
     aaggccgaat tgccgggcga ggtgctgccc gacaaggtat cgcagcggct gggccttgcc       420
     ggctcctacc acgaccatgt cctcaatgcc cgcgttgact accaggtgac caggagcatt       480
     ctcggcctga tcatcatgta tttttcgggt gccgcggccg gccttatggg aatcggcgcc       540
     ggcatcttca aggtgccggc aatggaccag gtgatgcgca tgccgttcaa agcctcgacc       600
     gccacctcca acttcatgat cggggtaacg gcggcctccg gcgcggtggt ctactttgtc       660
     cggggcgacg tgaatccgtt gattacgggg ccggtggtgc tgggggtctt gctgggagcg       720
     ctggtgggag cccggctgat ggtcaggatg aagacgacca ccatccgcaa gctcttcatc       780
     ccgctgatca tctacacggc cgtcatgatg atgtacaagg gggtcagtcc gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page