(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE24

CP002031.PE24        Location/Qualifiers
FT   CDS_pept        complement(33656..34492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0024"
FT                   /product="TPR domain lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82887"
FT                   /protein_id="ADI82887.2"
FT                   /translation="MKQLTMPLTALALFTLGGCVTNSDLDVVRRDLDELKNRQFQVEKE
FT                   VGGVRTEATARIESSFKDLDTERAGVRKGLADLQAAMDGIKVDMQVLAGKVDDVGLAAK
FT                   KPGDDLILLREDLERRLTAFDQRLAKAETGIEALQKKVAEQAPSPKETEKPTPEALYQK
FT                   GLDAYRAGNYGVARESFTRFLEQHPKHELAANARYWTGETYYSEKKFEQAILEFQEVIK
FT                   NYPGKEKVPAAMLKQAAAFSEIGDAKSARFVLRKLADDYPSSEEAKRAKDRLKELK"
     atgaaacagt tgaccatgcc cttgacggcc ctcgcccttt tcaccctcgg agggtgtgtc        60
     accaacagtg acctggacgt tgtccggcgc gatctagacg aactcaaaaa ccgccagttc       120
     caggtagaga aagaggtcgg cggcgtccgg accgaggcga ccgcacgcat tgaaagctct       180
     ttcaaggatc tggatacgga gcgggccgga gtacgcaagg ggctggccga cctgcaggcg       240
     gccatggacg ggataaaggt ggacatgcag gtgctcgcgg gcaaggtgga cgacgttggg       300
     ctcgccgcca agaagccggg cgacgatctg atcctcctgc gagaggatct ggagcgcagg       360
     ctcacggcct ttgaccagcg actggccaag gccgagacag ggatcgaggc gctgcagaaa       420
     aaggtggccg agcaggcacc ctcgccgaag gaaacggaaa agccgactcc cgaagccctg       480
     taccagaagg gactcgacgc ctaccgggcg ggaaattacg gcgttgcccg cgaaagcttt       540
     acccgcttcc tggaacagca tcccaagcac gaactggcgg ccaacgcccg gtactggacg       600
     ggcgagactt actacagcga gaagaaattc gaacaggcga ttctggaatt ccaggaggtc       660
     atcaagaact acccgggcaa ggaaaaggtg ccggccgcca tgctcaagca ggcagcggcc       720
     ttctctgaga tcggcgatgc caaaagcgct cgcttcgtcc tccgtaagct tgcggacgac       780
     tatccctcct cggaggaggc taaacgggca aaagacaggc tcaaggagct aaaatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page