(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE242

CP002031.PE242       Location/Qualifiers
FT   CDS_pept        247103..247648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83107"
FT                   /protein_id="ADI83107.1"
FT                   /translation="MGIPEDIHLFEQSLNELVIKYEQYFLGIEKREPLRLRETVDRLAR
FT                   KHSAVKIVNTMLNFKYTSLVSRYASYRQYWDRILRLMEEGKYSRDRFRMAIHERSSPEV
FT                   RQHEPPPPKDEAEELYRQFVEARRSCNLSTDKVSRDQVAAAIERQKPVIKAKYGTDQVE
FT                   FRVVVEDGVPKIKARPRR"
     atgggaatac ctgaagacat acacctgttc gagcagagcc tcaatgagct cgtcatcaag        60
     tacgagcagt acttcctcgg tatcgagaag cgggaacccc tgcgtctgcg ggaaacggtc       120
     gaccggttgg cgcgcaagca ctcagccgtg aagatcgtca ataccatgct caacttcaag       180
     tatacctctc ttgtttcccg ctacgccagt taccgccagt actgggaccg aatcctccgg       240
     ctcatggaag aagggaagta ctcgcgggac cgcttcagga tggcgatcca cgaacgttca       300
     tcaccggagg tgcggcagca tgaacccccg cctcccaagg atgaggcgga agagctctat       360
     cgccagttcg tggaggctcg ccgttcctgc aacctttcca cggacaaggt ctcccgcgat       420
     caggtcgccg cggccatcga acgccagaag ccggtcatca aagccaagta cggcaccgac       480
     caggtggaat tccgtgtggt ggtggaagac ggcgtgccca agatcaaggc ccgtccccgc       540
     cgctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page