(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE246

CP002031.PE246       Location/Qualifiers
FT   CDS_pept        complement(252237..253409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0247"
FT                   /product="efflux pump, RND family, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83110"
FT                   /protein_id="ADI83110.1"
FT                   /translation="MNDAMEQTSAKPVRSVLLWAFVVAFILFFIWAYVYRVDQTTRGIG
FT                   SVISSSRVQVIQAVDGGVLQSLKVKEGDRVRRGQVVALLDQTRSGASVRELDARLAAMK
FT                   AQSARLRAEVLGSPSVAFPPELRGFPELVKVQQALFDQRRQSLREELRTLDVAVKLARE
FT                   DAHLVAQLAKTGDVSRSEVIRSERALNDAEAQLINRKNKYYQDASAELAKIEDEINQNE
FT                   QVRTQRNQQLFDSVMKTPVDGIVKNVRVTTQGGVLRSGEELMQIVPLDDKLIIETKVKP
FT                   SDIAQIRPGLPAAIRFDAFDYTIHGAVDGTVAYVSADTIKEESKAGEQTYYRVHVEIAG
FT                   SNPVRTRTGKQLDIIPGMTAQVDIRTGSRTVLDYLLKPLRKTMTESMGER"
     atgaatgacg ccatggaaca gacatcggcc aagccggtcc gctcagtgct gctgtgggcc        60
     ttcgtcgttg ccttcattct ctttttcatc tgggcgtacg tttatcgtgt cgaccagacg       120
     acccgcggga tcggctcggt catttccagc agccgggtcc aggtcattca ggcagtggac       180
     gggggagtgc tccagtctct gaaggtaaag gaaggtgacc gggtcaggcg cggacaggta       240
     gtggccttgc ttgaccagac ccgctccgga gcttcggtca gagagctcga cgcccggctg       300
     gcggcgatga aggcccaatc ggccagactc cgggccgagg tgctgggctc tccgtcggtc       360
     gcatttcctc ccgaattgcg cggcttcccg gagctggtca aggtacagca ggcactgttc       420
     gatcagcgac gccagagcct ccgcgaagag ttgcggaccc ttgacgtcgc ggtaaaactt       480
     gcgcgggagg acgcccacct ggtggcgcag ttggccaaga ccggcgacgt gagccgctca       540
     gaggtgatca ggagcgaacg ggcattgaac gatgccgagg cacagctgat caaccggaaa       600
     aacaaatact accaggatgc aagcgccgag ttggcaaaga ttgaggacga gatcaaccag       660
     aacgaacagg tgaggactca acgcaaccag caactgttcg acagtgtcat gaaaactccc       720
     gtcgacggaa tcgtaaaaaa tgtccgcgtc acgacccaag ggggcgtgct ccgctccggc       780
     gaggagctca tgcagatcgt cccacttgac gacaagctga tcatcgaaac caaggtgaag       840
     ccgtccgata tcgcccagat ccgaccgggc ctgcccgcag caatcaggtt cgacgccttc       900
     gactatacca tccatggtgc ggtcgacggt acggtcgcct atgtcagcgc agacaccatc       960
     aaggaggagt ccaaagcggg cgagcagacc tattaccggg tccatgtcga gatagccggc      1020
     agcaatccgg tcaggacgag aaccggtaag cagctggaca tcatacccgg catgacggcc      1080
     caggtggata tccgtaccgg cagccggacc gtgcttgact acctgctcaa accactgcgc      1140
     aagaccatga ccgaatcgat gggcgagcgc tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page