(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE252

CP002031.PE252       Location/Qualifiers
FT   CDS_pept        complement(278622..280424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0253"
FT                   /product="sensor histidine kinase, GAF and GAF
FT                   domain-containing, nonconserved putative heme-binding site"
FT                   /note="domains: GAF, GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83116"
FT                   /protein_id="ADI83116.1"
FT                   /translation="MAVHDPYTILSSAIRIANATERSHDERLKTLALLIAEAFGALSAT
FT                   FYLLDGDGRVIVRKISSAFSDICSRDCRIPGGRGIAGLCASSGKPIRQDCAGCHPDEVV
FT                   TGNERTIAAFPVSCQGQSLGVLALGFAHDAPLTDDDRDMLAVVLIEAAGVMRCKRQLES
FT                   VEKRIRELSFLNRINGVMLSTIELNRLIHLLLTALTSDQPPLFDRAMLFLLNERAGILQ
FT                   GMMGITSARQTDSNAPSEPRTKRRFPVRNADFDSVVKATRLPLDASLNQISRAVLERTL
FT                   LHVQHPDQEQPVDRTLTKQFGTSSYAVAPLVSQDRVVGAIVVDNRLTDRPLAGDDLGIL
FT                   HLVSGQAGMAIENSILFHRLEETNRNLQDAKERLLQEEKLAAIGRMAASIAHEIKNPLV
FT                   SVGGFAGRLKRKFTPESEEWLYADVIGREVQHLEKMLSDILFFSRKTTICYTRCGINQI
FT                   IEDGLATMAVPLEQREIVVDKRFASRLPTLLGDCQQLRHVFTNLISNALDVMEPQGVLT
FT                   IETGLARIDGKRAVSVKVGDTGSGIAPDVRHSIFTPFFTTKEKGTGLGLAIVHRIITNH
FT                   GGRIEVENRPEGGALFTVVLPTSP"
     atggctgttc acgatcccta caccatactg agcagcgcca ttcggatcgc caacgcgacc        60
     gagcgctccc atgatgaacg gctcaagacc cttgcccttc tcattgccga ggcgttcgga       120
     gccctttccg ccacattcta tcttctggac ggcgacggcc gtgttatcgt ccgcaaaata       180
     tccagcgcct tctccgacat ctgcagcaga gactgccgta ttcccggcgg acgcggcatt       240
     gccgggctgt gcgcctcaag cggcaagccg atccggcagg actgcgcggg atgccatccc       300
     gatgaagtcg taacgggcaa tgaacgaacc atcgctgcct ttccagtcag ctgccaggga       360
     cagtctctgg gggtcctcgc cctggggttc gcccatgacg cgcccctgac cgacgacgac       420
     cgggacatgc tcgccgtagt cctcatcgaa gctgccggcg taatgcgctg caagcgtcag       480
     cttgaatcgg tggaaaagcg tatcagggaa ctctccttcc tcaaccgcat caatggggtc       540
     atgctgtcga ccattgagct caaccggctc atccacctgc tgctgacagc cctcacgtcc       600
     gaccagccgc cactgttcga tcgggccatg ctctttctgc tcaatgagcg cgccggcatt       660
     ctccagggga tgatgggcat cacgtcagca cggcagaccg acagcaacgc gccgtccgag       720
     ccaaggacaa agcgacggtt ccccgtccgg aacgccgact tcgactccgt cgtcaaggcc       780
     acccgcctcc cccttgatgc gtccctcaac cagatatccc gggctgttct ggagcgcacc       840
     ctgctccacg tgcagcatcc cgaccaggaa cagccggttg accggaccct cacgaaacag       900
     ttcggcacat cgtcctatgc agtcgctccc ctcgtgtccc aagaccgcgt tgtcggcgcc       960
     attgtcgtcg acaaccgtct cacggaccgc cccctggccg gcgacgatct cggcatcctc      1020
     cacctggttt ccggccaggc cggaatggcc atcgaaaact cgatcctttt ccatcggctc      1080
     gaagaaacga accgcaacct tcaggacgcc aaggagcgac tccttcaaga ggaaaaactg      1140
     gcggccatcg gccggatggc ggccagcatc gctcacgaga tcaagaatcc tctcgtttca      1200
     gtgggaggct ttgccggcag gctcaaaagg aaattcaccc ccgagtcaga ggagtggctt      1260
     tacgccgatg tcatcgggcg cgaggtgcag catctggaaa aaatgctgag tgacatcctc      1320
     tttttctcgc gaaaaaccac catctgctat acccgctgcg gcatcaacca gatcatcgaa      1380
     gacgggctgg caaccatggc cgtccctctg gaacagaggg agattgtcgt tgacaagcgc      1440
     ttcgcctccc gcttgccgac cctgctgggc gattgccagc agctccgtca cgtcttcacc      1500
     aacctgataa gcaacgccct ggatgtcatg gaaccgcagg gggttctcac catcgaaacc      1560
     ggcctggcac ggatcgacgg caagcgggcc gtatccgtca aggtgggcga caccggcagc      1620
     ggcatcgccc ccgatgtccg tcactcgatc ttcaccccct tctttaccac caaggaaaaa      1680
     gggaccggtc tcggcctcgc catcgtgcac cggatcatta ccaaccacgg cggacggatc      1740
     gaagtcgaaa accgacccga aggaggcgcc ctcttcacgg tagttctccc cacgtcaccc      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page