(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE261

CP002031.PE261       Location/Qualifiers
FT   CDS_pept        288616..288948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83126"
FT                   /protein_id="ADI83126.2"
FT                   /translation="MIMLQRLWTFILVTAWCLVPPFTKNGSPCAGTAASVGSRGPGGVQ
FT                   RDLAPLARFLSCPESGVDHNGELSLFIPHCPALAGPLLLFRLKRTGFSLCRALIREGGI
FT                   LLSARR"
     gtgataatgc tgcaacggct gtggacattc attctagtga cggcatggtg cctcgtgccg        60
     ccgttcacca aaaacggcag cccctgtgcc gggactgccg catctgtcgg ttcacgtggt       120
     ccggggggcg tgcagaggga cttggcacca ctggcccgct tcctttcctg ccccgagtcg       180
     ggggtcgacc acaacggtga gctgtcgctc tttatccccc actgtccggc cctggccgga       240
     ccgttgttgt tgttccgtct caagcggacc ggcttctccc tgtgccgtgc cctgatccgt       300
     gagggaggta tcctgctctc ggcgcgccgt tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page