(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE269

CP002031.PE269       Location/Qualifiers
FT   CDS_pept        296918..298882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83134"
FT                   /protein_id="ADI83134.1"
FT                   /translation="MPHRLHLEQFGPVHALPVLHYRLEFAHLVREAVRRVKPDCIAIEL
FT                   PSTIEAPFLRAVERLPEISVIHYEGRQRRDGAESVYLLVEPADPLVEGARLALERRIPL
FT                   RLVDVDTDSYPRHVEALPDSYAIHRIGLTPYYEEYRRAAASVAPGREDRRRERGMAWRL
FT                   QELAKEHGSILFVCGMYHLERIKDDFGRPQAAPLERVRRQGVRLFNLHPDSCREILDEF
FT                   PFISAVHELRRGPLPPEPDDRGETLRKRFSAFELIVGGRKDLPAEELLRHAVERGARHA
FT                   GRGEEFPDRQRIIFRLFQEAARHYRQETGDPVHLWQKRAFFRFARNYALASGALLPDLF
FT                   QLLMAARGCVDDNFAYALWRLATFYHWQRAEADIPTISISPEEIWGGSRRIRFRPRERR
FT                   RKGLSHLGFLKRKKEKRPGEWLEGFTDPSICSYPPEDVLIEEYGRFLKKKGAMQLSEEL
FT                   SRTEPFTSSLLDGIDLRETLRNVADGRVYVRESQRAKGGVGSVVVIFDEDRENGNYPYR
FT                   TTWLGEHEQESDMAFYATPPEDNIVGPGICRCEYGGFLLSSPPRRMMDVWRDPDYVFAR
FT                   SKPEVLLLAALDYSPEKHVVHVAARPPRSIFRQIAARMGKKIVHIPLGSLSSVKLKSIR
FT                   VLHILHGHDKRQVAKDYIW"
     atgccccatc gcctccacct ggaacagttc ggccccgtcc atgccctccc cgttctccac        60
     tatcgcctgg agttcgcaca tctcgtccgc gaggcagtgc gccgcgtcaa gcccgactgc       120
     atcgccatcg agttgccgtc cacgatcgag gcgccgttcc tgcgggcagt ggagcgcctg       180
     cccgagatat cggtcatcca ctacgaaggt cggcagcgcc gcgatggcgc cgaatcggtc       240
     tacctcctgg tggaaccggc cgatcccctg gtcgaagggg cgagactggc cctggagcgg       300
     cggattcccc tgcggctcgt ggatgtggac accgactcct atccccgcca tgtggaagcg       360
     cttcccgact cctacgccat tcaccggatt ggcctcaccc cctactatga ggagtaccgg       420
     cgtgcggccg cctctgtggc gccgggccgg gaggatcggc ggcgcgagcg gggaatggcc       480
     tggcggctcc aggaactggc aaaagagcat ggcagcattc tctttgtctg tggcatgtac       540
     catctggagc ggatcaagga cgatttcggg cggccccagg ccgctcccct ggagagggtg       600
     cggcgccagg gggtgaggct gttcaatctg catcccgact cctgccggga gatcctcgac       660
     gagtttccct ttatttcggc ggtccatgaa ctgcgtcgtg gtcctctgcc gcctgaaccc       720
     gacgatcgcg gcgagacgct ccgcaagcga ttcagtgcgt tcgagctaat tgtcggcggg       780
     aggaaggacc tcccggcgga ggagcttttg cgccatgcgg tagagcgggg tgcccggcat       840
     gcggggcggg gggaggagtt ccccgaccgg cagcggatca tcttccggct cttccaggag       900
     gcggcccgcc actaccggca ggagacgggc gacccggtcc acctctggca gaagcgggcc       960
     tttttccgtt ttgcccgcaa ttatgccctt gcctcgggcg cactcctgcc cgatctgttt      1020
     cagctgctca tggcggcacg ggggtgtgtg gacgataact tcgcctacgc cctgtggcgc      1080
     cttgccacct tctaccactg gcagcgggcc gaggcagaca tcccgaccat cagtatctct      1140
     cccgaggaaa tctggggcgg gagccgccgc atccgtttcc gcccacggga gcggcgccgg      1200
     aaagggctgt cgcatttggg ctttctcaag cgcaagaagg aaaagcgccc cggagaatgg      1260
     ctcgaaggat tcactgaccc gagcatctgc tcctatccgc ccgaggatgt gctgattgag      1320
     gagtatggcc gctttctcaa gaaaaaaggg gccatgcagc tttccgagga actctcccgt      1380
     acggagccgt tcacctcgtc acttctggat gggatcgatc tgcgggaaac actgcgcaac      1440
     gttgccgacg ggcgggtcta tgttcgggaa agccagcgag ccaagggggg cgtgggctcg      1500
     gtggtcgtca tcttcgacga agaccgggaa aacggtaact atccctaccg cacgacctgg      1560
     ctgggcgagc acgagcagga atcagacatg gccttctatg cgacgccgcc ggaggacaac      1620
     atcgtcggtc ccggcatctg ccgctgcgag tacggcgggt ttcttctctc ctccccgccg      1680
     cgccggatga tggatgtctg gcgcgacccg gactatgtct ttgcccggtc aaagccggag      1740
     gtgcttctcc tggccgctct cgactattcg cccgaaaagc atgtggtcca cgtggctgcc      1800
     cggccacccc gcagcatctt ccggcagatc gccgcacgaa tggggaaaaa gattgtccac      1860
     atccccttgg gctccctttc gtcggtaaag ctcaaatcca tccgggtgct tcatatcctg      1920
     cacggtcacg acaagcgtca ggtggccaag gactacatct ggtga                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page