(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE281

CP002031.PE281       Location/Qualifiers
FT   CDS_pept        complement(312283..312711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83146"
FT                   /protein_id="ADI83146.2"
FT                   /translation="MRQALAELSVLPGAIGSLVTDRGGKILERVFPPLFDDTTLSAVSE
FT                   DLAECVITLGISSVSTETLFLRYTEGIVAIKPLDDGLLLLLCTRESSGKSITCAIDAAA
FT                   ARLRRVMSPAPPSVQVGPNGPASDRLAIAMSSESYPAK"
     atgagacagg cgcttgcaga actcagcgtg cttcccggtg ccatcggcag cctcgtcacg        60
     gatcgcggcg ggaagatcct cgaacgagtg tttcctcctc tctttgatga cacgaccctg       120
     tctgcggtct cggaagacct ggctgaatgc gtgataaccc tcggcatctc gtccgtcagc       180
     acagaaacgc tcttcctccg gtacacagag ggaatcgtag cgataaaacc cctcgacgac       240
     ggcctgcttc tgctcctctg caccagagaa tccagcggca aatcaatcac ttgcgccatt       300
     gacgccgcag cagcccgact ccggagggtg atgtccccag cccccccttc cgttcaggtc       360
     ggcccgaatg ggccggcatc tgaccggctg gcaatcgcta tgtcatcaga atcttacccc       420
     gcaaaataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page