(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE283

CP002031.PE283       Location/Qualifiers
FT   CDS_pept        313793..314524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83148"
FT                   /protein_id="ADI83148.1"
FT                   /translation="MKYVNAFVLMILLASQSIDAHAFGSMGGMGGGGAVSVQSTPLAGK
FT                   VVETFNSGGYTYVSLERDGKTVWAAIPETSLEVGREVTLKPGMEMQQFFSKALNRTFDS
FT                   IYFSEGLATQAASTKGKSSAGSKGGVVTPAEKIAVEKAAGANGFTVAELHGNREKLDGK
FT                   TISVRAKVTKVSAGIMGKNWLHLQDGSGDSSKGSHDLTVTTQDLPALGEVVTVTGTLRK
FT                   DKDFGGGYKYDAIVEDGTVSH"
     atgaagtatg tgaatgcctt tgttcttatg attctgcttg catcccagtc cattgatgcc        60
     cacgccttcg gctccatggg cggcatgggc gggggtgggg cggtctctgt acagagtacc       120
     cctctggcag gcaaggttgt ggagacgttc aacagcggcg ggtataccta cgtcagtctt       180
     gagcgggacg gtaagaccgt atgggccgcc attcccgaga cttcactcga ggtcggccgc       240
     gaggtgactc tcaagccggg catggagatg caacagttct tcagtaaagc ccttaaccgg       300
     acctttgaca gtatctattt ttccgagggg ctggcgaccc aggccgcaag caccaaggga       360
     aagagctcgg ctggaagcaa ggggggggtg gtcactcccg cagagaagat tgctgtagaa       420
     aaggccgctg gggccaatgg cttcactgtt gccgagctcc atggcaacag ggagaaactt       480
     gacggcaaga cgatcagtgt ccgggccaag gtgaccaagg tgtcggccgg catcatgggt       540
     aagaactggc tgcatcttca ggacggctcc ggcgacagct cgaagggaag ccatgatctg       600
     accgtgacga cccaggacct cccggctttg ggcgaagtgg tcaccgtcac cggaacgctc       660
     aggaaggaca aggatttcgg cggcggctac aagtatgacg cgattgtgga agacgggacg       720
     gtttcgcact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page