(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE30

CP002031.PE30        Location/Qualifiers
FT   CDS_pept        complement(38533..39312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0030"
FT                   /product="nitrilase/amidohydrolase superfamily protein,
FT                   class 5"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82893"
FT                   /protein_id="ADI82893.1"
FT                   /translation="MNRTVKAGAVQFTVRLGDIDANVAYVQKALRRLASQGCRLAVLPE
FT                   MWSTGYAYKELNELAKRTPEVVAELGRLSRELEMVIVGSMPEPHGEKVFNTAYVLDRGE
FT                   LLGSYRKIHLFSLMGEDRSLDGGDRWLVVDTHVGRLGVFICYDLRFPELARRLAVEGAE
FT                   IIVVPAEWPKPREEHWRALLRARAIENQLFVVAANCCGVQGKLDFFGSSLIIDPKGELL
FT                   AEGGYDPCEPMATLDFQVMETWRDQIPCFADRRPSCY"
     atgaatcgga ccgtcaaggc aggagccgta cagttcactg tcaggctcgg cgatattgac        60
     gcaaacgtgg cgtacgtcca gaaagccctg cggcgactgg catcccaggg atgccggctg       120
     gcggttctcc ccgagatgtg gagtaccggc tacgcctaca aggagctcaa cgaactggcc       180
     aagcggaccc ctgaagtggt ggcggaattg ggccggctct ccagggaact ggagatggtc       240
     atcgtcggca gcatgccgga gccccacggt gaaaaggtct tcaataccgc gtatgttctt       300
     gatcgtggcg agttgctcgg ttcctatcgc aagatccacc tcttctccct catgggagag       360
     gaccgctccc tagacggcgg cgaccggtgg ctagtggtcg atacccacgt gggtcggctc       420
     ggcgtcttca tctgctacga ccttcgcttc ccggagctgg cgcgccggct ggcggtggaa       480
     ggagccgaaa tcatcgtcgt ccctgccgag tggcccaaac cgcgggaaga acactggcgg       540
     gcgctgttgc gggcccgggc catcgagaac cagctcttcg tggtggccgc caactgctgc       600
     ggagtccagg gcaagctcga cttcttcggc tccagcctga tcatcgaccc caagggagag       660
     ctcctggccg aaggcggcta cgacccatgc gaaccaatgg caaccctcga cttccaggtg       720
     atggagacat ggcgcgacca gataccctgc ttcgccgacc gcaggccttc ctgctactga       780
//

If you have problems or comments...

PBIL Back to PBIL home page