(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE321

CP002031.PE321       Location/Qualifiers
FT   CDS_pept        350979..351383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83186"
FT                   /protein_id="ADI83186.1"
FT                   /translation="MGELKPMTTESVKELLEEAGAKAMARSGRTESYSAPRDFSFEVKA
FT                   IFPNGMGLHIVARQFNYRDPWEATGRVNDLVDVSLLRDGIYTPLPKGYKWFQGRDLEEG
FT                   VDEARLRELIACVRDVNPKLYLLQELTGDL"
     atgggagaac tgaaaccgat gaccacggag tcggtgaaag aactgctgga agaggctggg        60
     gctaaagcca tggcacgctc ggggagaact gaaagttaca gcgcgccccg ggacttttcc       120
     ttcgaggtca aggccatctt ccccaatggt atgggacttc acatcgttgc gcggcagttc       180
     aactaccgcg atccgtggga agcgacaggg cgagtcaatg atctggtcga cgtttcattg       240
     ctgcgggatg gcatctacac tccccttccc aagggataca aatggttcca ggggcgcgat       300
     ctggaggaag gggtggatga ggcacgactg agggaactca tagcctgtgt ccgcgacgtc       360
     aatccgaagc tttatctgct ccaggaattg acaggagact tgtag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page