(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE324

CP002031.PE324       Location/Qualifiers
FT   CDS_pept        complement(354733..355236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0326"
FT                   /product="periplasmic nitrate reductase, iron-sulfur
FT                   cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83189"
FT                   /protein_id="ADI83189.2"
FT                   /translation="MAGRWFLFRFLSGYWSAARNIGAATPVCRPPRFKETASGSCGDCT
FT                   ACRDACPSAIIVRDFARKGPHLDFFQGRCTFCYLCAGACPKGILTLPNEGERMVIGRAR
FT                   LIRDRCLVREGCSVCIERCPEGALTLIFGRTIRVSKRKCTGCGGCRHVCPAKPNAMSIE
FT                   PLNG"
     atggcaggac gctggtttct gttccgattc ttgtccggtt attggagtgc ggcgcggaac        60
     atcggcgcgg ctacccccgt gtgccgaccg ccgcgattca aggaaaccgc atctggctcc       120
     tgcggcgatt gcaccgcctg ccgggatgcc tgtccctcag caattatcgt gcgtgacttt       180
     gcccgaaagg gaccgcacct cgactttttc caggggcgct gcaccttttg ctacctctgc       240
     gccggggctt gccccaaggg cattctgaca ctgccaaacg aaggggaacg catggtgatc       300
     ggcagagccc ggttaatccg tgaccgctgc ctggttcgcg aagggtgttc cgtctgcatt       360
     gagcgctgtc ccgagggagc gctcaccctc atcttcggca gaaccatccg ggtgagcaaa       420
     cgaaaatgta ccggttgcgg cggctgcaga catgtctgcc cggcaaagcc gaacgcgatg       480
     agtattgagc cgttgaacgg ctag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page