(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE325

CP002031.PE325       Location/Qualifiers
FT   CDS_pept        complement(355556..356932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0327"
FT                   /product="sigma-54-dependent sensor transcriptional
FT                   regulator, PAS domain-containing"
FT                   /note="domains: PAS, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83190"
FT                   /protein_id="ADI83190.2"
FT                   /translation="MRIEPQPLHLPVFRAILASMGEGIIFADADDRIRYINAAAEEIRG
FT                   IIAGNYLGRSIVSIHSPASEGRIRRLIAGLKGGDIPFSTRVIHVREKIFENSYYPIRNE
FT                   NGTYEGTLLISRDITEKERLKEENNSLREQVRADFACGGMIGKSHAMEPVFHMIRATAA
FT                   LDSTILISGESGTGKELVACAIHQMSPRHKNPFVKVNCAALPETLLESELFGHERGAFT
FT                   GAVRERKGKFEQAHLGTIFLDEIGEMPLAAQAKLLRVIQGKTLERIGGNREIVVDVRII
FT                   AATNKDLRREVERGAFREDLFYRLNVIPIHLPPLRERREDILSLAEHFLSVYAERMRKP
FT                   VRCIAPDARKALLDYDYPGNVRELENAIERGVALSMGETITLADLAPYFVTGASAAPAG
FT                   AALPKDPPAATLSRAVSVAEQEAIREALQTTGNRKGVAAKLLGISRKTLWEKLKQMERT
FT                   "
     gtgcgcatcg aaccacagcc acttcatttg cccgtttttc gggcaattct cgccagcatg        60
     ggagagggga tcatcttcgc cgacgctgac gacagaatcc gctatatcaa tgcggccgcc       120
     gaggaaatcc gcgggatcat cgccggcaac tacctggggc ggagcatcgt ctccatccac       180
     tcacccgcgt ccgaagggcg catccgtcgg ctcatcgccg ggctcaaggg gggggacatc       240
     cctttttcca cccgcgtgat ccacgtaagg gaaaagatct tcgaaaacag ctactacccc       300
     atccgaaacg agaacggtac atacgagggg actcttctga tctcgcggga catcaccgag       360
     aaagagcgcc tcaaggaaga aaacaactcc ttgagggagc aggtacgcgc cgacttcgcc       420
     tgcggcggaa tgatcggaaa aagtcatgcc atggaaccgg tgttccacat gatcagggct       480
     acggcagccc ttgattccac catcctcatc tccggcgaaa gcgggacagg caaggaactg       540
     gtggcctgtg ccatccacca gatgagcccg cgccacaaga atcccttcgt caaggtaaac       600
     tgcgccgccc tcccggaaac gcttctggaa tcggaacttt tcggccacga gcggggagca       660
     ttcacggggg cggtgcggga acgcaagggg aaattcgaac aggcccacct gggaaccatt       720
     ttcctcgacg aaatcggcga gatgcccctg gccgcccaag caaagctgtt gcgcgtaatc       780
     cagggaaaga ccctggagcg gatcggaggc aaccgcgaga tcgtcgttga tgtgcggatc       840
     atcgctgcca ccaacaaaga tctgcgcagg gaagtcgagc gcggggcctt tcgggaagac       900
     cttttttacc gcctcaacgt cattcccatc catctgccgc cgctcaggga gcgccgtgaa       960
     gacatcctct ccctggctga gcactttctg tccgtctacg cagagcggat gcgcaaaccg      1020
     gtccgctgca tcgccccaga cgcccgcaag gcactcctgg actatgacta cccggggaac      1080
     gtccgggagt tggagaatgc cattgagcgg ggcgtggccc tgtcgatggg cgagaccatc      1140
     accctggccg atcttgcccc ctacttcgtg acgggagcat ccgcggcgcc ggcaggtgcc      1200
     gctctcccca aggatccacc ggcggcaacc ctctcccggg cggtatccgt cgccgaacag      1260
     gaggccatcc gtgaggcgct gcagacaacc ggcaaccgca agggggtggc ggcaaaactc      1320
     ctcggcatct cccgcaagac tctttgggaa aaacttaagc agatggagcg cacgtaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page