(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE326

CP002031.PE326       Location/Qualifiers
FT   CDS_pept        357204..358493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0328"
FT                   /product="peptidoglycan-binding outer membrane protein,
FT                   OMP_b-brl and OmpA domain-containing"
FT                   /note="domains: OMP_b-brl, OmpA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83191"
FT                   /protein_id="ADI83191.1"
FT                   /translation="MKQRIVPGLLALAAIAVTAAPALAENRSGAGYISPFVGGYTFDGA
FT                   QHLKTRPTFGLRGGYNLDKNWAAELLLGYVPTKQSRGQGNDADAYRYGLDVLYNFMPDS
FT                   ALVPFLAVGGGASTIDHSEGVSDEHEQYVNYGGGLKYFLTDNFALRGDVRHIYMLGPEN
FT                   HNFEYTVGLNYLFGGERPAPAKVAAPPEPPKAVEPPPPAPAPKKEIAPPPPPPAPAPKD
FT                   TDGDGVIDDLDKCPDTPAGVKVDSVGCPLDTDKDGVYDYLDKCPGTPAGVKVDSVGCPL
FT                   DTDGDGVYDYLDKCPDTPKDLAVDAKGCPERICITLGVQFDTDKAVVKPQYNDEIKKAA
FT                   DFLKEYPDATAVIEGHTDSVGSDAYNQKLSERRAKAVMKYLVDKFGISAKRLSAKGFGE
FT                   SKPIADNATEEGRYKNRRVVAVIDCGMKKR"
     atgaagcaac gaatcgtgcc cggactgctt gccctggccg cgatagccgt cacggccgcg        60
     ccagcactcg ccgaaaacag gagcggagca gggtacatct ctccctttgt gggcggctac       120
     acgtttgacg gcgcacagca cctgaaaacc cgtccgactt tcggtctgag aggcggctac       180
     aacctggaca agaactgggc cgctgaactg ctcttgggct atgtccccac caagcagagc       240
     agggggcagg gaaatgacgc ggatgcttac cgttacggtc tcgacgtcct ctataacttc       300
     atgcctgaca gcgctctggt gccgttcctc gccgtaggcg gcggcgcatc caccatcgat       360
     cactccgaag gggtgagtga cgagcatgag cagtatgtga actacggtgg cggcctcaaa       420
     tacttcctga ccgataattt cgcacttcgt ggcgacgtgc ggcacatcta catgctcggc       480
     cccgaaaacc acaattttga gtacacggtg ggactcaact acctctttgg cggtgagcgc       540
     cccgcgccgg ccaaggttgc tgcacctccc gagccgccta aggccgtcga gcccccgcct       600
     ccggcccccg cgcccaagaa agagattgca ccgcctcctc cgcctccggc tcctgcaccc       660
     aaggatacgg acggtgacgg ggtaatcgat gacctggaca agtgccccga tacccctgcg       720
     ggcgtgaagg tcgatagtgt cggttgtcct ctcgatacgg acaaggacgg cgtttacgat       780
     tacctggaca agtgccccgg cacccctgcc ggcgtgaagg tggacagcgt tggttgtcct       840
     ctcgatactg acggcgacgg cgtctatgac tatctggaca agtgccccga cacgcccaag       900
     gatctggcgg tcgacgcaaa aggttgcccc gagcgcatct gcatcactct cggcgttcag       960
     tttgacaccg acaaggccgt ggtcaagcct cagtacaatg atgagatcaa gaaggccgcc      1020
     gacttcctga aagagtaccc cgacgcgacc gccgtcattg aagggcacac cgacagcgtc      1080
     ggaagcgatg cttacaatca gaagctttcg gagcggcgtg ccaaggcggt catgaagtat      1140
     ctggtcgaca agttcggtat cagcgccaag cgtctctcgg ccaagggctt cggcgagtcc      1200
     aagccgattg ccgacaacgc taccgaagaa ggtcggtaca agaaccgccg ggttgtggcg      1260
     gtcatcgact gcggtatgaa gaaacgctga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page