(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE328

CP002031.PE328       Location/Qualifiers
FT   CDS_pept        359745..360200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83193"
FT                   /protein_id="ADI83193.1"
FT                   /translation="MAQVFDFTRLRRLTIIHVFVQAFLLILLVGTTSVLLGKVPSQVFM
FT                   NSVIRVVVLQLILFYPVYKLAASDAEREVASAVTGLPAEEMQALRRKRVFSDILKGALI
FT                   IFFFTFILRAPGAPQIQFSILAVFLLSYLAYFQCFNSVAKRLMRAKS"
     atggcacagg tgtttgattt tacgcgactg cgcaggctga cgattattca cgtatttgtt        60
     caggcctttc tgctgattct ccttgtcggc accacttctg tgcttctcgg caaggttccg       120
     tcccaggttt tcatgaacag tgtcatcagg gtcgtggtgc tccaactgat ccttttttat       180
     cccgtgtaca agctcgcggc ttcggatgcg gagcgtgagg tggcatcggc cgtcacgggg       240
     ctacccgccg aagagatgca ggccctgcgc cgcaagaggg tattcagcga catcctcaag       300
     ggcgcgctga tcatcttttt tttcacgttc atcctgaggg ctcccggcgc cccccagatc       360
     cagttctcca tcctcgccgt cttcctcctc tcctacctgg cctactttca gtgtttcaac       420
     tcggtcgcca agcggctcat gcgcgccaag agctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page